STORYBOUND
violalilith
  • Reads 14
  • Votes 5
  • Parts 9
  • Time 2h 12m
  • Reads 14
  • Votes 5
  • Parts 9
  • Time 2h 12m
violalilith
Ongoing, First published Aug 04, 2024
adventurecamaraderieconflictdarkenemiesfantasyfriendshipguardianhousesisekaikingkingdomlovemagicnovelreaderreincarnationstoryboundsurvivalswordswar
Frieda Chad, a sophomore and avid bookworm, has always lived a pretty dull life. With no friends and all her excitement stuck between the pages of fantasy novels, she craves something more. But when she accidentally knocks herself out while reading one night, she wakes up inside the very book she was so engrossed in. Thrust into a world of magic, swords, and adventure, her once-boring existence turns into a wild, heart-pounding journey. But there's more to this story than meets the eye-inner kingdom conflicts and a looming massacre are just the beginning. What true bookworm wouldn't jump at the chance to meet their favorite characters in real life? But in this twisted reality, the adventure is about to get a whole lot more intense.
All Rights Reserved
adventurecamaraderieconflictdarkenemiesfantasyfriendshipguardianhousesisekaikingkingdomlovemagicnovelreaderreincarnationstoryboundsurvivalswordswar
Table of contents

9 parts

Sign up to add STORYBOUND to your library and receive updates
or
#693guardian
Content Guidelines
You may also like
The Rarest Gem by jjemswrites
12 parts Ongoing Mature
All I have to hold on to is my belief system, the idea that real magic exists, can be channeled, and can help me transform my life for the better. Hey, I'm Tristan. I'm nineteen and spend most of my days trying to avoid my angry, controlling mother, who thinks all my ideas are evil and that I need to grow up and become a regular man. The truth is, nothing is regular about me, and I refuse to be changed, even if it means keeping everything hidden. I have a best friend who gets me and is the only one in my life who accepts my quirks and crazy ideas, or so I thought until I met him, until I met Logan. He's more alluring than anything magical I've encountered, and I need to experience him for all that he is. The path to connecting our hearts is difficult because of so many opposing factors, but I'm not one to give up. I've always believed in magic, and there's nothing more magical than him. There is nothing more magical than us.
The Blessed Kingdoms[COMPLETED] by TypanErza
31 parts Complete Mature
Where there is light there is darkness. The unity & peace of Aether was challenged .The ruler of the Earth elemental Kingdom sowed the seed of chaos. The War broke out like plaque infecting everyone. Blood flowed creating a new Amazon of blood. Bodies and distorted limbs piled up everyday to form a mountain of rotting humanity. Deactivation, is what they called it. This bought in a need, the need, a remedy, a hope ,the peace keeper; The Main Capital Kingdom. ------------------------------------------------------------- Footsteps echoed in the ghostly cold and empty corridor. It came to halt at the entrance of a room. "You called for me, sir? " a voice broke the silence of the vast richly furnished room, receiving attention from the man sitting on the huge carved mahogany chair, facing away from the door . "The file is on the table ." The person voiced out placing file with the royal Tsuchikami symbol. "Don't let me down, Stretton. " The man seated on the chair spoke in his loving voice. "Kingdom of Tsuchikami should be the best and powerful Kingdom of Aether. " A smirk plastered on his face hearing a retreating footsteps.
Discovery by SJFaerlind
18 parts Complete
Raised to hold certain beliefs and conditioned to pursue the future her parents always dreamed of for her, Clarissa’s life is thrown into sudden and unexpected chaos when she learns that she has a rare talent for magic. She is angry and resentful that her perfect future has been stolen from her by this revelation and resists embracing her new circumstances, fighting to return to the life she always thought she wanted. A surprise enemy attack on the academy where the king’s mages are trained sets her on the road to adventure, danger and realization. The road is painful at times, yet Clarissa emerges from it at the end with the most important discovery of all. She has discovered the kind of person she wants to be.
Retreat into Darkness by helswrites
62 parts Complete Mature
#1 in sword fighting #3 in darkforest #7 in weapons #12 in gory #25 in mysterious (THIS BOOK HAS MANY GRAMMATICAL ERRORS, it's slowly being edited!) Allaura Aislinn always dreamt of living in a fairytale. She never thought a world of chaos would ever come find her. Until one day, it did. Join Allaura into her journey of finding out who she truly is and where she truly belongs.
The Prince's Guard by crhwriting
15 parts Ongoing
When Zara becomes the personal guard of Prince Asher she assumes the hardest part will be protecting him, little does she know that his older brother will be. - After a simple goodbye dinner turns into an eventful and emotional night, Zara is offered a job as an assistant personal guard for prince Asher. Moving into the palace, going to the best school in the country, and having an amazing job, what could possibly go wrong? Well to say the least, a lot goes wrong. From her brother feeling abandoned, Asher feeling like an outsider, and managing new friendships, Zara's life has never been more complicated. And that's not including Asher's older brother, prince Luken, who has made it his mission in life to make Zara miserable. Luken is the complete opposite of his caring and sensitive brother. Zara despises him for how he treats Asher and he despises her for, well... breathing. However, no matter how much they hate one another, they are still stuck living together. Though, is it even possible for these two to actually come to good terms? Will Luken ever let his walls down and show Zara his true self, and will Zara ever give him the chance? Read The Prince's Guard and follow Zara as she battles her way through friendships, enemies and possible love. *NOT FULLY EDITED / UPDATES EVERY FEW DAYS!*
The Bane of the Empire by AnnyVirdi
41 parts Complete
The world is ruled by a tyrant King. The Old King was killed and with him the magic that coursed through the world was sealed away. Dawn Rentradie, a human girl, is sent to Eastmaw to collect a tome that triggers a sequence of events that places her in the path of a Fae warrior named Hunter. Follow Dawn, as she uncovers the secrets of a world just out of reach but all around her. Turns out magic wasn't just a children's story. Genre: Young adult, High Fantasy, Adventure, Romance, Fae Folklore
A Tale of Two Daggers by YoussefSameh680
42 parts Complete Mature
At a certain juncture of time in the Middle Ages. A tyrannical king ruled his kingdom with an iron fist. His every whim was law, and his subjects lived in constant fear of his wrath. This is the story of his reign and another two brave souls... A 17-year-old girl finds herself trapped in a cycle of fear and danger. When one fateful day came, a huge army swarmed her hometown only to capture the gorgeous of them all, and that would be the start of her long and everlasting nightmare... On the other hand, one young prince found himself involved in a conspiracy cooked for him. However, he meets an unexpected maid who will save his life but also unknowingly turn his future into a daily bogey of horror and fear. Can the girl attain a sense of peace despite the challenges in the forthcoming sections? Will the conspirators succeed in their sincere desire to eliminate the prince? Above all, what is the correlation that exists between them and the king? ***(No smut included )*** Note: This book is cross-posted (or will be posted) on RoyalRoad.com with the same user name. Here is my profile link: https://www.royalroad.com/profile/600838
Just Another Fairy Tale by QueenCheesecake1
20 parts Complete
A dying princess, a reluctant mortal, an intergalactic historian, and several, SEVERAL assassins. Prepare for sass. The ancient world of Rhoessmoure seems peaceful in its humble, primitive ways, perhaps even perfect. But then the war hit. In a kingdom of sorcerers, one girl makes it her life mission to peacefully resolve this war, hiding the fact that it's all simply a distraction for dealing with the burden of guilt she carries. The only problem? She has eight months to live, is the heir to the throne, and has a boat ton of bounty hunters after her. Will she be able to solve the war before her time is up, or will she die defending the world she loves? Read this story with the narrative of an intergalactic historian and uncover a world of magic, guilt, and heartache.
Six Rulers by skyefulloflightning
13 parts Ongoing
A young Queen, recently ascended, lives in a seemingly good world. Until one of her best friends gets himself mixed up in the wrong stuff. The young Queen must stop the forces of evil and help her friend, but at what cost?Ol
A World with No More Pain!! (Male Reader X Anime MMORPG Harem) by JackDroid
30 parts Complete
You are Y/n L/n and You were A Loser With No Family and no Friends Just going to school and having A Miserable existence or that was until you saved A Girl from being hit by A Car and you woke up to Meet A Dragon God who Offers you A New kind of existence; The kind of You dream of; A MMORPG Anime world where you meet new Friends, Go On A New Friends, and Battle new Villians! You Might Finally have A Shot at A Wonderful Existence after all!
You may also like
Slide 1 of 10
The Rarest Gem cover
The Blessed Kingdoms[COMPLETED] cover
Discovery cover
Retreat into Darkness cover
The Prince's Guard cover
The Bane of the Empire cover
A Tale of Two Daggers cover
Just Another Fairy Tale cover
Six Rulers cover
A World with No More Pain!! (Male Reader X Anime MMORPG Harem) cover

The Rarest Gem

12 parts Ongoing Mature

All I have to hold on to is my belief system, the idea that real magic exists, can be channeled, and can help me transform my life for the better. Hey, I'm Tristan. I'm nineteen and spend most of my days trying to avoid my angry, controlling mother, who thinks all my ideas are evil and that I need to grow up and become a regular man. The truth is, nothing is regular about me, and I refuse to be changed, even if it means keeping everything hidden. I have a best friend who gets me and is the only one in my life who accepts my quirks and crazy ideas, or so I thought until I met him, until I met Logan. He's more alluring than anything magical I've encountered, and I need to experience him for all that he is. The path to connecting our hearts is difficult because of so many opposing factors, but I'm not one to give up. I've always believed in magic, and there's nothing more magical than him. There is nothing more magical than us.

More details