Suits (By Your Side)
QueenWriter17
  • Reads 1,042
  • Votes 10
  • Parts 35
  • Time 4h 3m
  • Reads 1,042
  • Votes 10
  • Parts 35
  • Time 4h 3m
QueenWriter17
Ongoing, First published Sep 01
Mature
3 new parts
comedydonnapaulsendramafamilyfriendshipharveyspecterjessicapearsonlawyerlouislittloyaltymikerossrachelzaneromanceseason3suitstwins
Sequel of Suits - (My Worst Partner-Enemy)

As Pearson Darby merge, Elizabeth faces the change slowly. Until a feud brings complications, Donna's love interest comes to light, a certain British lawyer, unlikely friendships, the Ava Hessington murder trial. Will it all turn out better? Or will everything become worse for Elizabeth?
All Rights Reserved
comedydonnapaulsendramafamilyfriendshipharveyspecterjessicapearsonlawyerlouislittloyaltymikerossrachelzaneromanceseason3suitstwins
Table of contents

35 parts

Sign up to add Suits (By Your Side) to your library and receive updates
or
Content Guidelines
You may also like
Outside your window (18+) by SmutH03
51 parts Ongoing Mature
|A stalker romance| When Trinity finally takes on her first case as a lawyer, she's completely oblivious to the fact that it might be her last, considering it made her the new obsession of a certain dangerous man. - "Unblock my number, Malyshka." A voice as deep as night says from next to me, the accent slipping with Russian. A warning, a threat..no. A promise. He knows I'm awake. Please read trigger warnings<3 UPDATES EVERY FRIDAY WARNING- THIS IS A DARK ROMANCE!!!
Where the Stars Fall by AnaSimons
48 parts Complete
How far would you go to protect the ones you love? A successful architect with a promising career in London, Brian's world spins out of control when the man he always saw as a second father betrays him in the most unexpected way. Left without closure, a year has passed and Brian is now more determined than ever to undo the harm done to the ones he loves most, his family. Even if that means riding the thin line between justice, revenge, and obsession... Immersed in his resolve, finding love again was the last thing on his mind. Until fate steps in and a chance encounter changes everything. Meeting Olivia again so unexpectedly, at his best friend's wedding, stirs up memories he had long ago put away. She'd been his first love, his kindred spirit - and the woman who left him without saying so much as a goodbye. Which doesn't make him want her less. He knows it, the moment she locks her deep green eyes on his. Even knowing it might be too late to repair what's been once broken, Brian refuses to lose her again and sets out to find a way back to her heart. But it's been more than ten years since their story was left unfinished. Will they get one last chance to make things right? Or will Brian learn that sometimes justice comes at too high a price? *** NOTE TO READERS: A full-length, standalone contemporary romance, Where the Stars Fall was previously published on Wattpad as Falling Home. This edition has been fully revised with added and edited content.
Falling For Mr. Greenfield by iliannabinoche
21 parts Complete Mature
Earning a bachelor's degree in business and owning a professional cleaning service gave her the financial security that too many young women craved but failed to obtain. Though Sorrow's business acumen gave her the freedom to make any decisions she wished, difficulties in her previous love life left Sorrow somewhat jaded concerning the opposite sex. Based on her experiences, Sorry Olivia Shay makes up her mind that decent men no longer exist. Instead of searching for someone to share her accomplishments with, she invests most of her time in building her business. All is well as far as Sorrow is concerned until one unexpected event occurs in her life. A loner his entire life, Eli Asher Greenfield has never been confused with the "Jock" or the "Life of the Party". For better or worse, Asher is the "Nice Guy," and unfortunately for him, they say nice guys always finish last... or do they? Prosecuting Attorney Greenfield is a socially awkward introvert, who manages to navigate the painful yet shameful existence of a divorcee. By focusing his attention on his career, Asher secures an existence with no further mishaps. With pencil-sharp features, a tall lean frame, and an air of nerdy sophistication that some might consider "Dorky Sexiness", Asher loses himself in work to shield himself from women and the failures he associates with them. What will become of Asher and Sorrow when their business relationship takes an unexpected turn for which neither of them is prepared? This is a Curvy Community Romance: #DISCLOSURE #CelebrateBlackStories #Curvy #Community #EyesLipsFierce ⛔️TRIGGER WARNING: This story is MATURE. There are explicit depictions of sexual acts written within the context of this story. If this is offensive or triggering for you, please do not read this story. Thanks.⛔️
Sugar Rush by hepburnettes
43 parts Complete
Social-recluse Parker Collins doesn't expect to cross paths with the girl whose life he ruined years ago. But in a cold world that's left him bitter time and time again, maybe she's all the sugar he needs. ***** When Sugar Pearce moves into apartment 2B, the last person she expects for an upstairs neighbour is Parker Collins, her high school crush. But he's hardly the popular golden boy that she remembers; now he's a quiet, hard-working lawyer who doesn't like company and doesn't date. So when Sugar keeps running into him, at work and in their steamy apartment laundry room, she can't help but feel that fate is giving them a second chance at love. But is she ready to face the secrets that pulled them apart all those years ago? Is he? [[word count: 100,000-150,000 words]] Cover designed by Lydia Carr Content And/Or Trigger Warning: this story examines the PTSD associated with being a survivor of sexual assault. All Rights Reserved. Copyright © 2020 by Noelle N.
Lottery // Harvey Specter by Stories_of_sonder
22 parts Complete
"You used to tell me that: love is lottery, but you got your numbers and you're betting on me. Are you still betting on me?" ~~~*~~~ Harvey Specter and Kyra Anderson were epic. He left, she stayed behind. Now he is broken, while she is breaking. It's been fifteen years. Are you still betting on me? [#3 in #suits] Suits fanfic (S6) It's perfectly able to be read if you haven't seen Suits, it's just a tragic love story in the world of lawyers and courtrooms. (Disclaimer: all rights belong to the makers of Suits and Me Before You)
I don't want to come back. by Navya73
23 parts Complete
What if Mike had kept his word? What if Mike hadn't gone back to Harvey? Set in 3x02
A Little Patience by FromJupiterToMercury
10 parts Complete Mature
Summary: 1993; you're a lawyer and on your way to meet your new client. Surprise; it's someone you knew, years ago... This fic contains heavy sin, Duff and Slash being the best friends, Stephanie Seymour being a bitch (sorry Stephanie if you read this) and a bit of angst (yeah, because y'know) Side note: I don't have a clue of how the judiciary system works in the USA, so don't @ me if there is incoherence :)
Bad timing by poppysmicswonder
13 parts Complete Mature
This story takes place right after Donna tells Harvey that she's leaving him to go work for Louis. Harvey is in therapy. Though all he wants from his doctor is more sleeping pills so he can stop having anxiety dreams about missing important meetings. Which is also happening in real life because he has not replaced Donna since she left to work for Louis, nor can he apparently manage basic administrative tasks like keeping an appointment calendar or checking his phone messages. Harvey forgot about meeting that afternoon. It's a new employer. Senior partner - Blake Harlow. I used a storyline from the show Suits at first and later picked up some scenes, as needed. The rest is my own imagination. (Disclaimer: all rights of the characters belong to the makers of Suits, I have one female original character at the beginning of this story and one male original character as it goes further.)
Rewritten ° Harvey Specter ✓ by -ScarsPetrova
40 parts Complete Mature
{HIGHEST RANKING #1 SPECTER} THIS BOOK CONTAINS SPOILERS TO THE SHOW! ❝you can't control who you care for.❞ a tale of two lawyers who work together but struggle to express their thoughts of each other. [completed, unedited (sequel: stalemate) ✓ cover by @remuslupout] [DISCLAIMER: ALL RIGHTS FOR GIFS AND PICTURES GOES TO THE ORIGINAL CREATORS! AS WELL AS THE ACTORS THEMSELVES. These were all found on the public domain! I only own the story itself!]
You may also like
Slide 1 of 9
Outside your window (18+) cover
Where the Stars Fall cover
Falling For Mr. Greenfield cover
Sugar Rush cover
Lottery // Harvey Specter cover
I don't want to come back. cover
A Little Patience cover
Bad timing cover
Rewritten ° Harvey Specter ✓ cover

Outside your window (18+)

51 parts Ongoing Mature

|A stalker romance| When Trinity finally takes on her first case as a lawyer, she's completely oblivious to the fact that it might be her last, considering it made her the new obsession of a certain dangerous man. - "Unblock my number, Malyshka." A voice as deep as night says from next to me, the accent slipping with Russian. A warning, a threat..no. A promise. He knows I'm awake. Please read trigger warnings<3 UPDATES EVERY FRIDAY WARNING- THIS IS A DARK ROMANCE!!!

More details