Story cover for Vampire Survival Guide: How To Rock A Vampire Outfit by ShavelleS
Vampire Survival Guide: How To Rock A Vampire Outfit
ShavelleS
  • WpView
    Reads 4,191
  • WpVote
    Votes 2,957
  • WpPart
    Parts 59
  • WpHistory
    Time 3h 44m
  • WpView
    Reads 4,191
  • WpVote
    Votes 2,957
  • WpPart
    Parts 59
  • WpHistory
    Time 3h 44m
ShavelleS
Complete, First published Sep 23, 2024
actionadventureamelieangelbansheecomedydramaelvesfamilyfantasyfriendshiphighschoolimmortalmagicmysteryotherworldparanormalqueenromanceroyalfamilyroyaltysupernaturaltriologyvampirevampireromance
"Crafting a multidimensional potion is easier than you think. Start by blending a cliché queen bee with an ill-tempered Vampire prince in one cauldron. Sprinkle in some secrets, betrayal, and confusion, but don't forget the positive ingredients - like Rico Marshall's underwear, a couple of Elves, and four tumultuous years. Finish it off with a venomous bite on the neck of the future vampire queen. Results may vary, but one thing is certain - Bayside will never be the same."


Book One of the Vampire Trilogy
All Rights Reserved
actionadventureamelieangelbansheecomedydramaelvesfamilyfantasyfriendshiphighschoolimmortalmagicmysteryotherworldparanormalqueenromanceroyalfamilyroyaltysupernaturaltriologyvampirevampireromance
Table of contents

59 parts

Sign up to add Vampire Survival Guide: How To Rock A Vampire Outfit to your library and receive updates
or
#129triology
Content Guidelines
You may also like
Beautiful Beast by lucyanneholland
35 parts Complete
My name is Kalista. They call me the beast. Kalista has been cursed by a powerful sorceress and is now a prisoner in her own palace. As petals fall from an enchanted rose, her fate and the sorceress's victory draw nearer. But Kalista refuses to be defeated so easily and uses her own magic to push against the bindings. Yet what if it is not enough and the only way the curse might be shattered is through the help of another? When Arawn crosses into the beast's domain, he has one motive: revenge for his brother's death. But as he draws nearer to the beast and is surrounded by invisible servants, magical banquets, and an enchanted forest, he realizes that this beast is much more complex and much more human than he first thought. As their paths intertwine, Kalista must risk opening her heart to another, while Arawn must learn to see past his hate and prejudice. Together, they struggle against spells, wolves, and time itself to break the curse. If they fail, Kalista will fall asleep and will never again wake.
Four Sets of Fangs by NovelistSadist
30 parts Complete Mature
Daphne is the first born Luna Queen, as her coronation draws closer and closer, with no mate in sight her parents fear managing the Kingdom may prove to be to much. But unknown to her parents that's exactly what Daphne wants, she's been training and preparing for this role her entire life, the last thing she wants is a mate to come in a steal her thunder. But what's she going to do when not one but four mates come out to greet her, will she fight the bond between them or eventually give in to this captive mate bond? Can be read as a stand-alone but makes more sense if you've read the first story, Three sets of Claws Titles #3 in Polyamory
Cursed by Wicked_C
36 parts Complete
"You were born a Vampire Hunter. You were trained one and above all, you got some freaky spell on you that binds you to the Vampire princess. And still you think it's not right to kill them all because they might be innocent." When greed and fear get mixed up with powerful magic, the outcome isn't always what we expect it to be. Young vampire Hunter Sky knows this more than anyone. After an experimental ritual that would bring vampire kind to their knees, the world turns against the blonde Hunter. While finding refuge in the most unexpected places, a much bigger threat comes to light. With the world too caught up in their fear for the young Hunter, Sky and her new friends must stop the danger themselves and bring balance back to the world. *** Awards: 🥇The Chromatic Awards 2019 | Vampire/Werewolf | 1st place 🥇 Golden Petal Awards | Action scene (CH14) | 1st place 🥉 The 2nd Ohana Awards | Vampire | 3rd place 🥉The Scripturam Awards | Adventure | 3rd place ~ completed ~
The curse and the heir by ElliesWriting
4 parts Ongoing Mature
In a post-war world, a normal girl named Sophia grows up. She moves to the rebellious north with her mom, into a mysterious estate of an equally rebellious Duke. Word has it that he is mentally unstable. She figures out that he is her father and right as she is about to accept her faith of being a duchess, unexcplainable things happen. Strange creatures awakens from under the estate and are killing people - and Sophia is to blame. Things are spiraling out of control and she have to flee for her life. Throw in a mad uncle, unknown magical abillities, an unexpected love and a world that is about to die - Sophia has to fight to survive in a threatning enviorment to save her family and friends. English is not my first language. There might be some errors. This story has kind of a slow start. Bare with me. This story is a totally new version of another story on my profile.
Saints Of The Mafia by MisTofDesire
68 parts Complete Mature
The Garden Of Blood Trilogy: Book Three Arden has just died leaving her family in danger of being over throned. She was the last living founding member. Now her sheltered granddaughter Crimson will see just how cruel and twisted the mafia world is supposed to be. For all she knew were the stories her granny told her. But now she will live her own story, praying that she survives it. ************** Phibionites are no ordinary religious group. They come from the writings of heresy hunter, Epiphanius. Although Christians, they have a different unique way of worshiping Christ. A scandalous worship of which involves a sex ritual. ********** THIS BOOK IS MATURE WITH EVERY POSSIBLE THEME. CAUTION⚠ Rated R❌ Mature 18+ NB:Can be read before book 2. This has more to do with book 1.
Smoke and the Wolf by thewolf12345
34 parts Complete
What can you do when the love of your life is a man? You feel the pull when you look deep in his eyes but what about others? Being raised as a commoner, only just becoming a prince, why can't life go right for you? Feeling confused about your life when your "mate" shows up claiming you. That's Azee's life. Thierry wanted his mate, no matter the cost. Everyone has challenges with their life, but can they fix it or make it worse. (The story is complete but there are still a lot of mistakes to go over. This I know so please bear with me as I change things)
Little Pet (Habit x Reader) by pinkcristmastree
20 parts Complete Mature
*warning this story is cringe, and was made while I was on heavy medication. This book is the reason you shouldn't do drugs, stay in school, don't do drugs.* (Book one) The game had started a year ago, and now he has put a job out. To kill your loved one, what will happen when you get stuck between death. Will you let yourself die, or make a deal with the devil himself. (Warning: swearing, violence, and other things. picture belongs to me)
Hell's Belles: Beginnings by KaylaWoods289
47 parts Complete Mature
In a world where all different creatures roam openly. There is only one rule that holds true. Stay true to your kind. A simple rule to those who were given it early on. A hierarchy of sorts training all races to only remain bonded to their own and to despise all others ... So what happens when the rule is tested? When a group of little girls, who were never told of the dangers, form a bond like no other. An atrocity to those who look upon them. These girls soon grow into woman who find their bond only growing stronger... impenetrable. But can these four different kinds of woman be able to weather the storm that is set to head their way?
Into The Wild ~ Book 3 ~ The Royal Blood Collection by xMishx
25 parts Complete Mature
Book 3 - The Royal Blood Collection Dahlia has been given a mission, one simple request from the benevolent king of province five. Find his uncle. Silas hasn't sent word to his family in over a month. The king believes that his uncle is fine, but Dahlia knows that he's worried. Her mission is to travel to the unrelenting wasteland of province three. In the hot desert, Dahlia searches for a man that she believes doesn't want to be found. She knows that she was specifically chosen for her ability to track and locate people. She's made a name for herself, doing the jobs where others have failed. Her reputation stands firm with a one hundred percent strike rate. She does not accept failure. Finding Silas and convincing him to return will create a whole new world of pain for Dahlia. Faced with a stubborn man, she wrestles with the thoughts that this might be the one mission where she fails. Believing that failure is not an option, Dahlia does the unthinkable. She breaks her cardinal rule, not realizing how much it will change her future. Dahlia's rules are not meant to be broken, but sometimes it's worth the chaos it causes. She will learn that life is not meant to be bound into a rigid space of conformity and in doing so, open herself to an entirely different life. **Book 3 in the series. It is strongly recommended that you read the books ~ Crimson Flame and Command My Heart first.** © This story is copyrighted. No part may be reproduced by any process, nor may any other exclusive right be exercised, without the permission of T.M. Watkins (xMishx) 2019
His Mortal Bride by Maddie_May01
47 parts Complete Mature
Being kidnapped is one thing. Being taken to a Kingdom full of immortal vampires, that's another thing. To everyone, Raven is nobody. If anything, she's an average 20 year old living in the Big Apple. Overlooked by everyone, even her own family, Raven is used to being a ghost. That was until Alec came to New York City. Sent by his family, the 143 year old vampire has a week to find her... His soulmate. He has one week to bring her home. One week to take her back to the Kingdom that one day he will rule. But who said bringing a beautiful mortal girl back to a Kingdom was easy? ♱ Sequel : Her Wicked Secret
You may also like
Slide 1 of 10
Beautiful Beast cover
Four Sets of Fangs cover
Cursed cover
The curse and the heir cover
Saints Of The Mafia cover
Smoke and the Wolf cover
Little Pet (Habit x Reader) cover
Hell's Belles: Beginnings cover
Into The Wild ~ Book 3 ~ The Royal Blood Collection cover
His Mortal Bride cover

Beautiful Beast

35 parts Complete

My name is Kalista. They call me the beast. Kalista has been cursed by a powerful sorceress and is now a prisoner in her own palace. As petals fall from an enchanted rose, her fate and the sorceress's victory draw nearer. But Kalista refuses to be defeated so easily and uses her own magic to push against the bindings. Yet what if it is not enough and the only way the curse might be shattered is through the help of another? When Arawn crosses into the beast's domain, he has one motive: revenge for his brother's death. But as he draws nearer to the beast and is surrounded by invisible servants, magical banquets, and an enchanted forest, he realizes that this beast is much more complex and much more human than he first thought. As their paths intertwine, Kalista must risk opening her heart to another, while Arawn must learn to see past his hate and prejudice. Together, they struggle against spells, wolves, and time itself to break the curse. If they fail, Kalista will fall asleep and will never again wake.

More details