Monster King
AllenTheodore
  • Reads 98
  • Votes 15
  • Parts 18
  • Time 3h 28m
  • Reads 98
  • Votes 15
  • Parts 18
  • Time 3h 28m
AllenTheodore
Ongoing, First published Sep 24
2 new parts
adventurebattledarkdeathdiplomacydwarveselvesfaefantasyfightingjourneykidnappinglgbtlovemonstersmythnewadultrankingregicideromancetravelvotingwaryoungadult
In a kingdom in the middle of war, Prince Artemis, the firstborn son of King Indris, struggles to prove his worth amidst the shadows of his adopted brother, Leo. As tensions rise between their southern kingdom and the western realm, Artemis finds himself embroiled in a battle against both external foes and his own insecurities. When a betrayal nearly costs him his life during a royal banquet, Artemis teams up with allies-Thorn, Mira, Elysia, Finn, Duran, and the northern Princess Sera-to save their land.
Despite the strained relationship, between Artemis and Leo, the Princes are forced to cooperate as their forces engage in relentless skirmishes against fierce opponents, including elves and fae beasts. 
Amidst the chaos of war Artemis learns that strength is not merely about skill in combat but also about resilience, honor, and the bonds formed in the crucible of conflict. As the kingdom braces for what lies ahead, Artemis must find his own path to glory and forge alliances that could change the fate of their world forever.
All Rights Reserved
adventurebattledarkdeathdiplomacydwarveselvesfaefantasyfightingjourneykidnappinglgbtlovemonstersmythnewadultrankingregicideromancetravelvotingwaryoungadult
Table of contents

18 parts

Sign up to add Monster King to your library and receive updates
or
#236ranking
Content Guidelines
You may also like
Crown of Feathers (Book 2 of the Crown Trilogy) by CrystalJJohnson
39 parts Complete Mature
THE WEIGHT OF THE CROWN IS FEATHERS COMPARED TO A BROKEN HEART. After a heartbreaking betrayal, Raelle prepares to face the man she was falling in love with as her enemy. Armed with her unparalleled gift and the knowledge that she can't undo the match the Statera chose for her, she accompanies the Lucent king to anoint Kyron as Stigian's next ruler. But what should be a simple ceremony turns into a war when the neighboring kingdom of shifters attacks. Raelle must join forces with her ex-lover to protect her people and the land which the Allaji want to ravish. But setting aside her heartache and resisting the pull of her bond with Kyron proves to be difficult even with both of their kingdoms hanging in the balance. CW/TW: Sexual Content and Violence
The Darkness In Between by Aellix
15 parts Ongoing
It is 417 AD and two children are growing up in the shadow of the crumbling Roman empire. They are on opposing sides of the war to control Britannia's future, torn between the old way of life and the new one. Only one of them can win the war, but can they both survive it? Dai is resigned to a life of poverty in the slums of Londinium, like his father and grandfather before him. When the king's men come knocking at his door, demanding his service, everyone is baffled. He is fed and clothed and educated to the highest standard, and he knows there must be a price to pay ... he just doesn't know what it could possibly be. Bria is a princess of the Silures tribe. She has chosen an engagement with a prince in exile, but until the time comes for him to come home and take his kingdom, she must pretend otherwise. She inserts herself into the heart of the enemy's court, hoping to take them down from within. The stakes are high, for one slip of the tongue could mean the destruction of her entire tribe.
Princess Turned Barter by FlowerMortician
14 parts Ongoing Mature
--- Mothers tell their children about monsters hiding under beds. They tell them stories and magical tales of green creatures with scaly skin and sharp teeth. Munching on their tiny, brittle bones as screams echo through the town, under crooked doors and into houses. Until one day, a knight in shining armour appears and saves the village folk, bringing vindication to the town and protecting all the scared villagers. But monsters aren't always green, or blue, or have scales or slime or sharp teeth. Sometimes the monster is human. With long legs, a thin frame, brown hair and a scar beneath her eye. And sometimes, to someone, the knight is the same person. --- Kyra's life has been drowning in death since she was young. The anger inside her has been ever growing until finally, Kyra decided to take action to stop the desecration once and for all. Princess Elena Maidell was coming back from a trading trip in Izivell until her life changed course abruptly. Formulating a plan to use the Princess of Maidell as a barter, can Kyra restore life into her village, or is death the last thing she'll see? Will the princess escape her captor, or find an even greater purpose than sitting on a throne all day ? -Duel Pov- Updates every Friday!
Chosen by kall_me_kai
57 parts Complete
Warings: abuse, suicide, self-harm This is an LGBTQ story Scarlett Rose is a princess forgotten by the world. Hidden and abused by her parents, she is finally bartered away in a political marriage to a prince she has never met. Taking her away from her miserable home, Prince Julian Thorn wins, if not her love, then at least her friendship. It's his sister Athena with whom Scarlett really hits it off and the two become fast friends That is, until The Competition is announced. A 'sport' that will prepare one of the Chosen candidates to become a king or queen, and cull the rest. As the newly engaged princess to one of the most powerful kings, Scarlett is almost certain to be one of the Chosen. For the first time in known history, not one, but two princesses are Chosen. Athena and Scarlett will have to compete to survive. What surprises lie in wait for them in The Competition? If one change has been made, what can they still rely on? Within Scarlett hides a secret even she doesn't suspect. Will their new friendship survive this baptism of fire?
A Country Falls (Greatest Thief 3) by juliecotewriter
48 parts Complete Mature
The uneasy stalemate between Zianna and Deorun is holding. Finn accompanies Tannix on a diplomatic mission to the Queendom of Navire, to ask Queen Avaloni if she will ally with Zianna when the fighting truly starts. Finn knows he's going to be left behind when Tannix and the knights join the army. He's determined to make every moment before then matter. Not only with Tannix, but with his two vastly different families-the thieves and the knights. When the time comes and Tannix and the men ride off, Finn expects to face months of uncertainty. Nervously waiting for news from the front and treasuring every letter Tannix manages to write. But Finn has a habit of ending up in the middle of things. The war is no exception.
Three Broken Kingdoms-Book 1 of the Lost Continent (Completed) by Gemejoe
68 parts Complete
'Medea Crimson took a deep breath, walked into the abyss and died. It wasn't for the first time.' Completed, first in the Lost Continent Series. Three Kingdoms on the brink. A war on the horizon. The peoples of the Lost Continent are forever divided. Three races vie for power: elves, valkyries and humans... For as long as anyone can remember, tensions between the valkyries, elves and humans have been high and war has always been on the horizon. But now as a terrifying new queen turns to their territories, valkyries, elves and humans alike will have to fight to survive against a threat unlike any they've ever seen before... A deadly general. A vengeful enchantress. A scheming sixth born princess. A fiery rebel. A traitorous nephew. War. Love. Hate. Betrayal. Duty. Fate. Revenge. And above all, power. The amazing cover was made by @Kitkattish.
𝐓𝐇𝐄 𝐇𝐔𝐍𝐓𝐄𝐑 𝐀𝐍𝐃 𝐓𝐇𝐄 𝐇𝐔𝐍𝐓𝐑𝐄𝐒𝐒 ˏˋ°•*⁀➷ by luvlylight
10 parts Complete
In the dense forests that have stood since time immemorial, the goddess Artemis watches over her domain as its eternal protector. For ages she has maintained balance throughout the woodlands alongside her faithful sisterhood. Into Artemis' solitary vigil comes an unexpected encounter that sparks a profound connection with a mortal visitor to her realm. A bond forms that challenges her notions of divinity and mortality. However, forces are at work seeking to disrupt the harmony Artemis has guarded for so long. Tragedy strikes in a shattering betrayal, breaking the bonds that had been formed. Left in a wake of anguish and wrath, Artemis sets out on a mission of vengeance to punish those responsible for the wrongs committed against her and her beloved forest home. Her journey will expose truths that lead straight to the heights of Mount Olympus itself. This is a timeless tale of divinity intertwined with mortality, and the lengths one will go to for retribution when profound betrayals cut deepest. It explores themes of love, loss, and the primal need for vengeance in the ancient realm of the gods.
A Clash Of Light And Thunder (War Of The Forgotten Lovers Book 1) by AzulMidnight
43 parts Complete Mature
Featured in Wattpad HighFantasy & Magic II 19-year-old Aria is ready to accept her doomed fate of marrying the cruel Lord Lathik. An alliance that will secure a large army for her hateful brother's war against the fae. When destiny intervenes and her carriage gets attacked by bandits, she falls into fae territory. Pulled from the grasp of death and captured by the handsome crown prince, she can only pray he will never find out she is the enemy kingdom's princess. The fae prince, Elvin, is haunted by his mother's final words of a great war to come, of lies told, and a girl with redwood hair at the center of it all. When he saves a human that fits that description with rare light magic powers, he must decipher if she will be a friend or a foe. Is there something more to the lingering pull they feel towards each other? Will years of hate between humans and fae win out? How are their fates intertwined by the past? -----.------- "Do you know what you are asking?" Elvin's baritone voice vibrated down Aria's back. His velvet tone trickled down her skin like a gentle touch. "Yes... I want to know. What it feels like to be held with care." Aria truly did want to know... this may be the only chance she would get. ------.------ War Of The Forgotten Lovers Book 1 Best Rankings: #1 out of 6.5k in Fae 09/07/21 #1 out of 14.3k in Elf 10/02/21 #1 out of 18.7 in FantasyAdventure 10/01/21 #8 out of 87.9K in YoungAdult 09/13/21 EDITING
Dusk of the Realm by MagickIsEternal
41 parts Complete
While the Fae of the Realm have long prided themselves on being the most powerful beings in any known world, Tarin Wulf is the most legendary of them all. With him leading the armies and protecting the royal family, the Fae could never imagine anyone being brave enough to challenge them. However, Tarin Wulf has a weakness: the young princess, Serena Dusk. When Serena is taken somewhere her fierce protector cannot follow, the Realm slowly begins its descent into war against both the Infernal race, and a darkness that goes much deeper into the Dusk family's history than any of them could have known. With each day that passes, the Realm comes closer to bending to the will of the Infernals and their leader: the one person Tarin Wulf has ever feared, and who might just destroy everything that he has grown to love. ₪ ALL RIGHTS RESERVED ₪ ©
The Lost Princess by gabbyh27
33 parts Complete
For 19 years Freya had to live her life as an orphan, with only a letter from her birth mother to guide her. When her birth father kidnaps her, everything changes. Turns out, she's the heir to two thrones. And now she must choose which one to rule. One, a kingdom of fae. The good ones. Her mother's family. Obviously the choice she should make... right? Two, a kingdom of demons. They kidnapped her, they hurt her, they control people with their minds. Yet, Freya can't help but be drawn toward the darkness. Not to mention, the mysterious male that everyone keeps warning Freya to stay away from. Despite the warnings, Freya is drawn to him like no other. When nothing is as it seems, it's hard for a 19 year old to figure herself out, let alone an entire kingdom. Join Freya as she discovers a world of mystical creatures and finds out where she fits among them.
You may also like
Slide 1 of 10
Crown of Feathers (Book 2 of the Crown Trilogy) cover
The Darkness In Between cover
Princess Turned Barter cover
Chosen cover
A Country Falls (Greatest Thief 3) cover
Three Broken Kingdoms-Book 1 of the Lost Continent (Completed) cover
𝐓𝐇𝐄 𝐇𝐔𝐍𝐓𝐄𝐑 𝐀𝐍𝐃 𝐓𝐇𝐄 𝐇𝐔𝐍𝐓𝐑𝐄𝐒𝐒 ˏˋ°•*⁀➷ cover
A Clash Of Light And Thunder (War Of The Forgotten Lovers Book 1) cover
Dusk of the Realm cover
The Lost Princess cover

Crown of Feathers (Book 2 of the Crown Trilogy)

39 parts Complete Mature

THE WEIGHT OF THE CROWN IS FEATHERS COMPARED TO A BROKEN HEART. After a heartbreaking betrayal, Raelle prepares to face the man she was falling in love with as her enemy. Armed with her unparalleled gift and the knowledge that she can't undo the match the Statera chose for her, she accompanies the Lucent king to anoint Kyron as Stigian's next ruler. But what should be a simple ceremony turns into a war when the neighboring kingdom of shifters attacks. Raelle must join forces with her ex-lover to protect her people and the land which the Allaji want to ravish. But setting aside her heartache and resisting the pull of her bond with Kyron proves to be difficult even with both of their kingdoms hanging in the balance. CW/TW: Sexual Content and Violence

More details