Monster King
AllenTheodore
  • Reads 150
  • Votes 19
  • Parts 30
  • Time 5h 54m
  • Reads 150
  • Votes 19
  • Parts 30
  • Time 5h 54m
AllenTheodore
Ongoing, First published Sep 24, 2024
4 new parts
adventurebattledarkdeathdiplomacydwarveselvesfaefantasyfightingjourneykidnappinglgbtlovemonstersmythnewadultrankingregicideromancetravelvotingwaryoungadult
In a kingdom in the middle of war, Prince Artemis, the firstborn son of King Indris, struggles to prove his worth amidst the shadows of his adopted brother, Leo. As tensions rise between their southern kingdom and the western realm, Artemis finds himself embroiled in a battle against both external foes and his own insecurities. When a betrayal nearly costs him his life during a royal banquet, Artemis teams up with allies-Thorn, Mira, Elysia, Finn, Duran, and the northern Princess Sera-to save their land.
Despite the strained relationship, between Artemis and Leo, the Princes are forced to cooperate as their forces engage in relentless skirmishes against fierce opponents, including elves and fae beasts. 
Amidst the chaos of war Artemis learns that strength is not merely about skill in combat but also about resilience, honor, and the bonds formed in the crucible of conflict. As the kingdom braces for what lies ahead, Artemis must find his own path to glory and forge alliances that could change the fate of their world forever.
All Rights Reserved
adventurebattledarkdeathdiplomacydwarveselvesfaefantasyfightingjourneykidnappinglgbtlovemonstersmythnewadultrankingregicideromancetravelvotingwaryoungadult
Table of contents

30 parts

Sign up to add Monster King to your library and receive updates
or
#17voting
Content Guidelines
You may also like
Princess Turned Barter by FlowerMortician
20 parts Ongoing Mature
Kyra's life has been drowning in death since she was young. The anger inside her has been ever growing until finally, Kyra decided to take action to stop the desecration once and for all. Princess Elena Maidell was coming back from a trading trip in Izivell until her life changed course abruptly. Formulating a plan to use the Princess of Maidell as a barter, can Kyra restore life into her village, or is death the last thing she'll see? Will the princess escape her captor, or find an even greater purpose than sitting on a throne all day ? -Duel Pov- Updates every Friday!
Golden Dawn by Estoria34
41 parts Complete
Two worlds collide in one epic tale. Artemisia had lived in isolation for almost her entire life, but when she one day encounters a strange creature in an abandoned laboratory - her whole life is shaken from the roots. The young woman stumbles into a magnificent new world at the brink of war with none other than her very own home. Artemisia is forced to question her own morals and her journey makes her into someone she never thought she will become. Suddenly her endless pursuit for human companionship is overcome with the desire to protect those she meet on her adventure and she is involuntarily drawn to a stranger she thought once to be the enemy... [Total Word Count: 82 461]
The Silent Kiss: A Cinderella Story (FINISHED) (2022) by aricoursonwriting
18 parts Complete
"How can I trust you?" "You'll have to learn." Isabella Magaroth was just a child when her new family arrived, though her tale was quite different than anyone could've ever imagined. Four years after her father's death, Isabella encountered the prince of the lands, Blake, and forced herself to shy away despite him clearly being interested in her health. In every tale, she had been made a maid, but in this tale, cruel unspeakable things happened in her household, and Blake vowed to his father that he would get her out at the right time; for if it was even a minute later, Isabella would've been murdered. The moment Ella followed Blake into the forest, she wandered into a new world that-even in the medieval times-was considered unreal; a world of witches and angels, magic and sorcery, and Prince Blake was the center of it all. For she had fallen for one of the fallen. *** This book is no longer a teaser! It is in progress as of Aug 26 2024!!!! (completed on October 11 2024) (Published 2022)
The Lost Princess by gabbyh27
33 parts Complete
For 19 years Freya had to live her life as an orphan, with only a letter from her birth mother to guide her. When her birth father kidnaps her, everything changes. Turns out, she's the heir to two thrones. And now she must choose which one to rule. One, a kingdom of fae. The good ones. Her mother's family. Obviously the choice she should make... right? Two, a kingdom of demons. They kidnapped her, they hurt her, they control people with their minds. Yet, Freya can't help but be drawn toward the darkness. Not to mention, the mysterious male that everyone keeps warning Freya to stay away from. Despite the warnings, Freya is drawn to him like no other. When nothing is as it seems, it's hard for a 19 year old to figure herself out, let alone an entire kingdom. Join Freya as she discovers a world of mystical creatures and finds out where she fits among them.
The Red Continent by epaul89
16 parts Complete
On the Red Continent, citizens don't protest war, they protest peace. Because in this land, conflicts once decided by clashes of rival armies are now settled in single combat between champions of royal blood. Caught between rival imperial powers and a population stricken with blood lust is Prince Leander Thorn and Princess Alexia Varela. Leander was never supposed to be his family's champion but Alexia was born to be hers. Beautiful and deadly with a tongue as sharp as her sword, Princess Alexia is the commoner's favorite distraction and the noble's biggest object of envy and desire. Alexia has never met her equal in or out of the arena, but that all changes when she meets Leander following his first victory. Despite her resistance she falls hard for the genuine Prince Leander. But when he is implicated in the assassination of Alexia's little sister Penelope Leander is drawn into the arena once again, but this time he faces a scorned Alexia convinced of his guilt. With the whole world watching and Leander refusing to fight, Alexia will have to decide whether to kill the man she loves or take a leap of faith and trust in his innocence.
Three Broken Kingdoms-Book 1 of the Lost Continent (Completed) by Gemejoe
68 parts Complete
'Medea Crimson took a deep breath, walked into the abyss and died. It wasn't for the first time.' Completed, first in the Lost Continent Series. Three Kingdoms on the brink. A war on the horizon. The peoples of the Lost Continent are forever divided. Three races vie for power: elves, valkyries and humans... For as long as anyone can remember, tensions between the valkyries, elves and humans have been high and war has always been on the horizon. But now as a terrifying new queen turns to their territories, valkyries, elves and humans alike will have to fight to survive against a threat unlike any they've ever seen before... A deadly general. A vengeful enchantress. A scheming sixth born princess. A fiery rebel. A traitorous nephew. War. Love. Hate. Betrayal. Duty. Fate. Revenge. And above all, power. The amazing cover was made by @Kitkattish.
The Darkness In Between by Aellix
17 parts Ongoing
It is 417 AD and two children are growing up in the shadow of the crumbling Roman empire. They are on opposing sides of the war to control Britannia's future, torn between the old way of life and the new one. Only one of them can win the war, but can they both survive it? Dai is resigned to a life of poverty in the slums of Londinium, like his father and grandfather before him. When the king's men come knocking at his door, demanding his service, everyone is baffled. He is fed and clothed and educated to the highest standard, and he knows there must be a price to pay ... he just doesn't know what it could possibly be. Bria is a princess of the Silures tribe. She has chosen an engagement with a prince in exile, but until the time comes for him to come home and take his kingdom, she must pretend otherwise. She inserts herself into the heart of the enemy's court, hoping to take them down from within. The stakes are high, for one slip of the tongue could mean the destruction of her entire tribe.
A Country Falls (Greatest Thief 3) by juliecotewriter
48 parts Complete Mature
The uneasy stalemate between Zianna and Deorun is holding. Finn accompanies Tannix on a diplomatic mission to the Queendom of Navire, to ask Queen Avaloni if she will ally with Zianna when the fighting truly starts. Finn knows he's going to be left behind when Tannix and the knights join the army. He's determined to make every moment before then matter. Not only with Tannix, but with his two vastly different families-the thieves and the knights. When the time comes and Tannix and the men ride off, Finn expects to face months of uncertainty. Nervously waiting for news from the front and treasuring every letter Tannix manages to write. But Finn has a habit of ending up in the middle of things. The war is no exception.
Kingslayer by 4nastas14
7 parts Ongoing
!very unfinished ATM! In the kingdom of Aemisha, Princess Denestra is sent by her father on a deadly mission to assassinate crown prince Keiran, his brother Deimos, and King Ares of Dreadmoor. Claiming she is only there to keep peace between the kingdoms, she infiltrates their court, prepared to fulfill her duty. However, as she spends time in Dreadmoor, Denestra finds herself discovering they are not the tyrants she expected. Struggling with her growing feelings and the secrets she uncovers, Denestra faces a dilemma: remain loyal to her mission or embrace a future she never anticipated with the people she was sent to kill.
THE HUNTER AND THE HUNTRESS ˏˋ°•*⁀➷ by luvlylight
10 parts Complete
In the dense forests that have stood since time immemorial, the goddess Artemis watches over her domain as its eternal protector. For ages she has maintained balance throughout the woodlands alongside her faithful sisterhood. Into Artemis' solitary vigil comes an unexpected encounter that sparks a profound connection with a mortal visitor to her realm. A bond forms that challenges her notions of divinity and mortality. However, forces are at work seeking to disrupt the harmony Artemis has guarded for so long. Tragedy strikes in a shattering betrayal, breaking the bonds that had been formed. Left in a wake of anguish and wrath, Artemis sets out on a mission of vengeance to punish those responsible for the wrongs committed against her and her beloved forest home. Her journey will expose truths that lead straight to the heights of Mount Olympus itself. This is a timeless tale of divinity intertwined with mortality, and the lengths one will go to for retribution when profound betrayals cut deepest. It explores themes of love, loss, and the primal need for vengeance in the ancient realm of the gods.
You may also like
Slide 1 of 10
Princess Turned Barter cover
Golden Dawn cover
The Silent Kiss: A Cinderella Story (FINISHED) (2022) cover
The Lost Princess cover
The Red Continent cover
Three Broken Kingdoms-Book 1 of the Lost Continent (Completed) cover
The Darkness In Between cover
A Country Falls (Greatest Thief 3) cover
Kingslayer cover
THE HUNTER AND THE HUNTRESS ˏˋ°•*⁀➷ cover

Princess Turned Barter

20 parts Ongoing Mature

Kyra's life has been drowning in death since she was young. The anger inside her has been ever growing until finally, Kyra decided to take action to stop the desecration once and for all. Princess Elena Maidell was coming back from a trading trip in Izivell until her life changed course abruptly. Formulating a plan to use the Princess of Maidell as a barter, can Kyra restore life into her village, or is death the last thing she'll see? Will the princess escape her captor, or find an even greater purpose than sitting on a throne all day ? -Duel Pov- Updates every Friday!

More details