The Bones Between Us
AriaOfStorms
  • Reads 116
  • Votes 18
  • Parts 5
  • Time 16m
  • Reads 116
  • Votes 18
  • Parts 5
  • Time 16m
AriaOfStorms
Ongoing, First published Sep 26
actionamnesiacursedarkfantasydarkromancedreamlandbooksenemiestoloversfaeriesfairfolkfantasyfriendshiphighfantasymagicmurdermutemysterypara-romantasyromancesacrificeslowburn
When the Kingdom of Nivon's curse petrifies their country, ripples bleed through the Veil, thrusting Florence between the truth about her lineage and their enemy's sacrificial son.
                                          🏹🏹🏹

Without a voice, Florence Kinsella never anticipated being buried alive--let alone the need to cry out for aid. Unfortunately for her, when the second explosion breaks the ground and she falls into a world unlike any other, a sadistic Prince captures her.

Raised as a spare pawn, Davian Mazdarim was born solely to die in place of his brother, Cahir. When the knife-happy heir drags an oddly dressed captive through the palace, believing her a Nivonian spy, he tries a new approach to interrogation.

As vivid nightmares begin tormenting Florence and the game between alliance and betrayal thins, she'll be forced to witness the bad dealings of both ancestors she never knew and a future that's been rewritten.

Pawn, Knight, and Bishop will join forces in a tender alliance, but only one can remain on the throne.

What is a King without his Queen?


|| Ariel meets Prometheus in this inspired Fairytale ||
|| Standalone ||
》Cover by Me《
All Rights Reserved
actionamnesiacursedarkfantasydarkromancedreamlandbooksenemiestoloversfaeriesfairfolkfantasyfriendshiphighfantasymagicmurdermutemysterypara-romantasyromancesacrificeslowburn
Table of contents

5 parts

Sign up to add The Bones Between Us to your library and receive updates
or
#213faeries
Content Guidelines
You may also like
Ace by antoniawritess
100 parts Complete Mature
[COMPLETE][EDITING] Ace Hernandez, the Mafia King, known as the Devil. Sofia Diaz, known as an angel. The two are arranged to be married, forced by their fathers, joining the two Mafia's. But Sofia eventually learns, even the devil was once an angel. Cover by @alluringathena *This book is more of a romance book than Mafia book and I hope you enjoyyy*
The Alpha King's Mate by Bookdragon2022
32 parts Complete
"Y-your H-highness? I-i'm sorry b-but t-there m-must b-be a-a m-mistake..." A loud growl sounded through the whole ballroom causing me to start shaking and a whimper to escape my lips. This caused the King to stop growling. He pulled me to his chest and yelled out to the whole ballroom. "MINE!" Audrey is an Omega in the Rapid River Pack. Lucas is the Alpha King, Ruling over all and his own pack, The Moonlight Eclipse Pack. Audrey is beaten daily loosing all hope of every meeting her mate. Lucas just wants his mate but feels like she doesn't exist. What happens when the two meet at the Annual Lunar Eclipse Ball? Credits to @M_Rainberry for the amazingly wonderful cover!!!
MISTRESS OF FLAME by CeCeLib
82 parts Complete
[ BOOK 1 OF AZITERA: YTHER'S QUEEN ] Consumed by avarice, the four human kingdoms-the Infernal Empire, the Kingdom of Caelum, the Kingdom of Treterra, and the Nayale Archipelago-betrayed their covenant with Yther of Azitera, the race blessed by deities, who protected humans for untold centuries. They slaughtered and defiled the beings that once protected them from storm, famine, poverty, and pestilence without mercy. Betrayed by the humans they protected, the Ytherians were enslaved. Their four queens were caged, chained, and imprisoned to serve as nutrients to the human kingdoms. The once prominent Ytherians were reduced to nothing but servants. As the four kingdoms of the human race prospered for many years since their betrayal, one news staggered them, causing them to tremble in fear and rally their armies to protect and defend their domain: Sollel-the Mistress of Flame, one of Yther's queens-had escaped her prison. Her flames will raze hell, ready to burn the souls of her betrayers. COMPLETED CECELIB | C.C. COVER: ASTRID JAYDEE
Marked by the Alpha by zabellerain
37 parts Complete
"You are mine," He murmured across my skin. He inhaled my scent deeply and kissed the mark he gave me. I shuddered as he lightly nipped it. "Danny, you are mine and only mine, you understand?" Daniella Saunders had a pretty rough life. After being heartbroken and betrayed by both her father and her boyfriend, Danny moves to a small town to find the comfort of her mother. Everything is not what it seems and soon, Danny finds herself in the middle of a world she didn't even knew existed outside of fiction novels and movies. Not only does the town seem bizarre, but her senses heighten, her temper is out of control, and her hunger amplify. Throw in an arrogant, selfish, sexy, possessive player who didn't even want her in the first place, her life just seamlessly attract madness. Especially with those creepy threats coming from a "Silver Bullet", she can't keep still.
The Girl He Never Noticed by sweetdreamer33
93 parts Complete
LIMITED TIME: Read this STEAMY Story and Earn FREE Bonus Coins From Dec 16- 22, read for at least 60 minutes and enter to win up to 120 Coins (5000 Winners) When billionaire bad boy Eros meets shy, nerdy Jade, he doesn't recognize her from his past. Will they be able to look past their secrets and fall in love again? ****** When Jade Collins goes to work for billionaire bad boy Eros Petrakis, all she thinks she'll be doing is making his coffee...but when sparks fly, the shy Jade (who wears a disguise to mask her beauty and the secrets of her past) and the fiery, cocky Eros (who is solely focused on business and doesn't believe in the distractions of love) begin to grow closer and closer. Will Eros be able to see past her disguise to the beauty within? And will Jade be able to tame his heart -- and her own -- once the man of her dreams finally notices her? ****** Officially now a series! Watch it for free on MediaCorp's Youtube Channel- MediaCorp Drama. [[Word Count: 150,000 - 200,000]] The Girl He Never Noticed (Book 1 + 2) by Neilani Alejandrino (Sweetdreamer33) Copyright © 2015. All Rights Reserved.
A Song of Gelato and Flambé by BksbyBkr
33 parts Complete
In the epic conclusion to the Devil's Deal series, Freya has one final chance to discover the full potential of her own power, and to use it to restore balance in the universe - once and for all. After the destruction caused by Roisin, Ferya and Torix come to terms with their losses and mistakes... And prepare for a final battle that will change everything.
The Exiled Alpha | ✓ by Silverless
37 parts Complete
"It's like he's a different breed of werewolf. Something... beyond us." • • • Adrienne Gage has spent her entire life being shunned and punished for her mouthy attitude, and being loyal to a pack which doesn't deserve her loyalty. It's been a year since her last punishment, and she's been walking on eggshells to keep herself in the clear. But now, that's all being threatened to be taken away if she doesn't abide by what the Alpha's son wants; and that's her as his Luna. At the same time, terrified whispers are circulating around. Mentions of a tyrant Alpha looking for a new pack to conquer. Adrienne thinks nothing of everyone else's paranoia. That is until she finds herself half conscious and being dragged away deeper into the woods with canines around her neck. Highest Ranking #1 in Paranormal Highest Ranking #1 in Werewolf Highest Ranking #1 in Romance Cover made by @Silverless COMPLETED
Hired To Love by JordanLynde
66 parts Complete Mature
Henley agrees to pretend to date millionaire Bennett Calloway for a fee, falling in love as she wonders - how is he involved in her brother's false conviction? ****** Henley Linden's brother is in jail for a crime he didn't commit, and she'll take any job to raise the money needed to free him. Soon, she's agreed to pretend to date millionaire Bennett Calloway for ten thousand dollars, so his mother will ease up the pressure on him to find a wife. But once Henley is enmeshed in Bennett's world, he falls for her, and she starts to have feelings for him as well. Despite her romance with Bennett, as she grows closer to the Calloways, Henley realizes they are somehow involved in her brother's conviction. Journeying deeper into a world of wealth and conspiracies, Henley is forced to rely on Bennett, though doing so could cost her everything. [[word count: 200,000-250,000 words]]
You may also like
Slide 1 of 8
Ace cover
The Alpha King's Mate cover
MISTRESS OF FLAME cover
Marked by the Alpha cover
The Girl He Never Noticed cover
A Song of Gelato and Flambé cover
The Exiled Alpha | ✓ cover
Hired To Love cover

Ace

100 parts Complete Mature

[COMPLETE][EDITING] Ace Hernandez, the Mafia King, known as the Devil. Sofia Diaz, known as an angel. The two are arranged to be married, forced by their fathers, joining the two Mafia's. But Sofia eventually learns, even the devil was once an angel. Cover by @alluringathena *This book is more of a romance book than Mafia book and I hope you enjoyyy*

More details