Digital Marketing services-Graphy Multimedia
graphymultimedia
  • Reads 3
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 3
  • Votes 0
  • Parts 1
  • Time <5 mins
graphymultimedia
Ongoing, First published Oct 19
brandingbusinessdigitalmarketingdigitalservicesgraphicdesigngraphymultimediaseowebhosting
Are you looking for affordable Digital Marketing services? So now its a great time to promote your business with Graphymultimedia company.
Graphy multimedia is a great choice to make your brand smart and virtual instantly with the help of our services.
Our company provides an ample number of tech services such as web hosting, website development, SEO, free domain registration, GMB, SMM and so on.

Get a free consulting now to contact on this number:- 9915150505
All Rights Reserved
brandingbusinessdigitalmarketingdigitalservicesgraphicdesigngraphymultimediaseowebhosting
Table of contents

1 part

Sign up to add Digital Marketing services-Graphy Multimedia to your library and receive updates
or
#403graphicdesign
Content Guidelines
You may also like
Wendizzy's Writer Room by Wendizzy
2 parts Ongoing
In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.
Ace by antoniawritess
100 parts Complete Mature
[COMPLETE][EDITING] Ace Hernandez, the Mafia King, known as the Devil. Sofia Diaz, known as an angel. The two are arranged to be married, forced by their fathers, joining the two Mafia's. But Sofia eventually learns, even the devil was once an angel. Cover by @alluringathena *This book is more of a romance book than Mafia book and I hope you enjoyyy*
The Boy Who Read Minds ✔️ by veronicasoli
70 parts Complete
Highest rank: #1 in Teen-Fiction and sci-fi romance, #1 mindreader, #2 humor Aaron's special power might just be the coolest- or scariest- thing ever! It's always helped with his bad-boy reputation, his rightfully arrogant all-knowing intimidation seemed to go a long way with his love life and somehow also his education. Until he met Violet, one of the smartest girls in school; a girl he's been using for years, zoning in on her mind to ultimately cheat on exams and steal the title of valedictorian. Until one day, Violet failed him. Her mind wandered all over the place- her parent's divorce, her breakup, and he couldn't help but sympathize. But Violet's a smart girl, who knows how long it'll take before she finds out. Aaron depends so much on his mind-reading capabilities that when they suddenly disappear- so does everything he hasn't worked for. His secret was like Samson and his hair, once it's told, the magic's all gone. Word count: [85,000 - 92,000] *** Copyright © 2021 #1 TEEN FICTION #1 mindreader #1 sci-fi romance #8 romance #2 humor #1 puberty #1 superpowers #1 sweet #35 comedy For business inquiries, please contact: wattpadveronicasoli@gmail.com BOOK 1 of the Mind Reader Series
Hired To Love by JordanLynde
66 parts Complete Mature
Henley agrees to pretend to date millionaire Bennett Calloway for a fee, falling in love as she wonders - how is he involved in her brother's false conviction? ****** Henley Linden's brother is in jail for a crime he didn't commit, and she'll take any job to raise the money needed to free him. Soon, she's agreed to pretend to date millionaire Bennett Calloway for ten thousand dollars, so his mother will ease up the pressure on him to find a wife. But once Henley is enmeshed in Bennett's world, he falls for her, and she starts to have feelings for him as well. Despite her romance with Bennett, as she grows closer to the Calloways, Henley realizes they are somehow involved in her brother's conviction. Journeying deeper into a world of wealth and conspiracies, Henley is forced to rely on Bennett, though doing so could cost her everything. [[word count: 200,000-250,000 words]]
The Boyfriend App by phenomenalpen
3 parts Complete
*Wattys 2018 Winner / Hidden Gems* CREATE YOUR OWN MR. RIGHT Weeks before Valentine's, seventeen-year-old Kate Lapuz goes through her first ever breakup, but soon she stumbles upon a mysterious new app called My Dream Boyfriend, an AI chatbot that has the ability to understand human feelings. Casually, she participates in the app's trial run but finds herself immersed in the empathic conversations with her customizable virtual boyfriend, Ecto. In a society both connected and alienated by technology, Kate suspects an actual secret admirer is behind Ecto. Could it be the work of the techie student council president Dion or has Kate really found her soulmate in bits of computer code? She decides to get to the bottom of the cutting-edge app. Her search for Ecto's real identity leads Kate to prom, where absolute knowledge comes with a very steep price.
My Fake Boyfriend by ToTheExtreme95
134 parts Complete
He was so close, his breath hit my lips. His eyes darted from my eyes to my lips. I stared intently, awaiting his next move. His lips fell near my ear. "Shut up and kiss me" He whispered roughly. A chill shot up my spine. I pulled back, staring at his eyes and leaned in.. ********** What happens when Alexis Dawson- "residential loser" of Redwood High, agrees to help Redwood High's player, Aaron Walker. How can she stop herself from falling for him? But it isn't all love and romance, Alexis has her own secret. Join them on the journey filled with jealousy, betrayal, trust, friendship and love. A little favour just got a whole lot more complicated.
Seduced ➢ Kylo Ren by alinaskywalker
55 parts Complete
⭐️ ᴛʜᴇ ᴍᴏꜱᴛ ʀᴇᴀᴅ ꜱᴛᴀʀ ᴡᴀʀꜱ ꜰᴀɴꜰɪᴄᴛɪᴏɴ ᴏɴ ᴡᴀᴛᴛᴘᴀᴅ ⭐️ ʜɪɢʜᴇꜱᴛ ʀᴀɴᴋɪɴɢꜱ ꜱᴏ ꜰᴀʀ: #1 ɪɴ ꜱᴛᴀʀ ᴡᴀʀꜱ (2017) #1 ɪɴ ᴋʏʟᴏ (2021) #1 IN KYLOREN (2015-2022) #13 ɪɴ ꜰᴀɴꜰɪᴄᴛɪᴏɴ (2017) (𝕤𝕖𝕥 𝕒 𝕔𝕠𝕦𝕡𝕝𝕖 𝕠𝕣 𝕤𝕠 𝕞𝕠𝕟𝕥𝕙𝕤 𝕒𝕗𝕥𝕖𝕣 𝕖𝕡.𝕧𝕚𝕚) started: december 20, 2015 finished: sometime early 2017 𝔻𝕀𝕊ℂ𝕃𝔸𝕀𝕄𝔼ℝ: *𝕚 𝕕𝕠 𝕟𝕠𝕥 𝕠𝕨𝕟 𝕥𝕙𝕖𝕤𝕖 𝕔𝕙𝕒𝕣𝕒𝕔𝕥𝕖𝕣𝕤 𝕟𝕠𝕣 𝕕𝕠 𝕚 𝕠𝕨𝕟 𝕥𝕙𝕖 𝕤𝕥𝕒𝕣 𝕨𝕒𝕣𝕤 𝕗𝕣𝕒𝕟𝕔𝕙𝕚𝕤𝕖* (𝕚 𝕨𝕚𝕤𝕙 𝕚 𝕕𝕚𝕕, 𝕓𝕦𝕥 𝕨𝕙𝕒𝕥𝕖𝕧𝕖𝕣)
Marked by the Alpha by zabellerain
37 parts Complete
"You are mine," He murmured across my skin. He inhaled my scent deeply and kissed the mark he gave me. I shuddered as he lightly nipped it. "Danny, you are mine and only mine, you understand?" Daniella Saunders had a pretty rough life. After being heartbroken and betrayed by both her father and her boyfriend, Danny moves to a small town to find the comfort of her mother. Everything is not what it seems and soon, Danny finds herself in the middle of a world she didn't even knew existed outside of fiction novels and movies. Not only does the town seem bizarre, but her senses heighten, her temper is out of control, and her hunger amplify. Throw in an arrogant, selfish, sexy, possessive player who didn't even want her in the first place, her life just seamlessly attract madness. Especially with those creepy threats coming from a "Silver Bullet", she can't keep still.
Ex-Husband Turned Boss by deetronite
35 parts Complete
[This story will become free on 3 January 2025] Down-on-her-luck Aubrey gets the job offer of a lifetime, with one catch: her ex-husband is her new boss. *** Aubrey Whitlock's life is turned upside down after her divorce, leaving her an unemployed, broke, and single 29-year-old. A chance meeting with her ex throws her for a loop again when he makes her an offer: come work with him as his assistant. Now a self-made billionaire, Bryce Roberts is just as infuriating-and good-looking-as he was the first time around. Their marriage was disastrous, but their chemistry is stronger than ever. Will they ever mend their relationship, or will it be nothing more than a heated game of seduction? And what will happen when Bryce discovers the secrets Aubrey has been keeping from him after all this time?
You may also like
Slide 1 of 9
Wendizzy's Writer Room cover
Ace cover
The Boy Who Read Minds ✔️ cover
Hired To Love cover
The Boyfriend App cover
My Fake Boyfriend cover
Seduced ➢ Kylo Ren cover
Marked by the Alpha cover
Ex-Husband Turned Boss cover

Wendizzy's Writer Room

2 parts Ongoing

In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.

More details