Story cover for Fantasy chronicles by Gandang_lalake123
Fantasy chronicles
Gandang_lalake123
  • WpView
    Reads 25
  • WpVote
    Votes 0
  • WpPart
    Parts 7
  • WpHistory
    Time 1h 17m
  • WpView
    Reads 25
  • WpVote
    Votes 0
  • WpPart
    Parts 7
  • WpHistory
    Time 1h 17m
Gandang_lalake123
Ongoing, First published Nov 03, 2024
adventurefantasyisekaiscifi-fantasyspacespacetravel
10,000 years before his fateful encounter with a group of students with firearms and their teacher, kaiceph is travelling towards another universe after the end of his mission, now he must fulfill a new task, a task that aligns with his and it was given by a goddess who pleaded for his help to fight against an enemy that would threaten the very fate of her domain.
All Rights Reserved
adventurefantasyisekaiscifi-fantasyspacespacetravel
Table of contents

7 parts

Sign up to add Fantasy chronicles to your library and receive updates
or
#712spacetravel
Content Guidelines
You may also like
Being A Mortal by StrangeAuthor123
7 parts Ongoing
A young demigod decides to go to the mortal world to learn about the world down below him. Kai enjoys feeling normal and meets many new friends, but where friends are, foes fallow. As he gets possibly too comfortable, things start to turn for the worst. Will he find the answers he's looking for? Will he make it back home? Will everything work out in his favor? Find all the answers through the eyes of someone born to be different, trying to fit in.
A Gamers Guide To A Multiverse of Fun (abandon) by Primordial_Void_Fox
11 parts Complete Mature
Velon Eveningshade learns that perhaps dying doesn't lead to the end, but rather a new journey. One dream ends, but another begins afterwards till the dreamer awakes.
A Guardian's Misadventure by HighLawmaker
6 parts Ongoing
Imbued with a power from beyond, what's a lost soul to do in an unfamiliar world not it's own?
Arknights: Genesis by The-All-Eternal
10 parts Complete Mature
A lone soul adrift in the void for countless of ages until a single rift appearing change it all, merging with the source of all things it gained the power to do anything as it enters a foreign and unfamiliar world, with neither it or the inhabitants of the new world know that there lives was about to change.
A New World Order (Multicross) by The-All-Eternal
13 parts Ongoing Mature
An accident leads to a random soul's ascension and they have mixed feelings about their new state of existence and to the strangers intruding their life.
Memetic Hazard(Arknights Modern AU) by HighLawmaker
7 parts Ongoing
One would expect a new chance in life would be exciting? Not so much when your a mental hazard to everyone and the worse part? The world ain't safe against him.
Kaleidoscope by dickweed7
16 parts Complete
Fifteen years into the future, the paladins we know and love are taken during a last-hurrah mission against some Galra resistance. As fate would have it, their children and proteges must travel the universe and fight to get them back, while also learning how to come to terms with their own identities and problems. Or a completely self-indulgent next generation voltron fan fiction :)keit
Howling Echoes by JesusVentura032
29 parts Ongoing
Like most Isekai, the main character gets teleported to another. Follow the story of a Super Soldier getting teleported to a world of swords and magic. What is his life going to be like? Only time will tell.
Yoru-Fall by MrCakepans
13 parts Ongoing
A story about 2 Best friends in a world like ours but with a type of magic. They get sent to a parallel dimension and have to survive and there way around this new mysterious place. PS. This is the first thing i ever wrote and i did think of it in like 10 mins so it will probable suck
Lone Carrier(AU Azur Lane) by HighLawmaker
30 parts Ongoing
Being reborn as a sentient ship during the early days of the second world war was not what she expected upon dying, yet she is determined to turn the tides of war and hope that old tragedies may be averted in one way or another.
You may also like
Slide 1 of 10
Being A Mortal cover
A Gamers Guide To A Multiverse of Fun (abandon) cover
A Guardian's Misadventure cover
Arknights: Genesis cover
A New World Order (Multicross) cover
Memetic Hazard(Arknights Modern AU) cover
Kaleidoscope cover
Howling Echoes cover
Yoru-Fall cover
Lone Carrier(AU Azur Lane) cover

Being A Mortal

7 parts Ongoing

A young demigod decides to go to the mortal world to learn about the world down below him. Kai enjoys feeling normal and meets many new friends, but where friends are, foes fallow. As he gets possibly too comfortable, things start to turn for the worst. Will he find the answers he's looking for? Will he make it back home? Will everything work out in his favor? Find all the answers through the eyes of someone born to be different, trying to fit in.

More details