Story cover for Book 2: Echoes of the Blood - The 100 (Raven Reyes x Reader) by BreezeHST
Book 2: Echoes of the Blood - The 100 (Raven Reyes x Reader)
BreezeHST
  • WpView
    Reads 333
  • WpVote
    Votes 20
  • WpPart
    Parts 2
  • WpHistory
    Time 34m
  • WpView
    Reads 333
  • WpVote
    Votes 20
  • WpPart
    Parts 2
  • WpHistory
    Time 34m
BreezeHST
Ongoing, First published Nov 10, 2024
Mature
abbygriffinbeccapramhedabellamyblakeclarkegriffinindrakomtrikrujasperjordanjohnmurphylexakomtrikrulunakomfloukrumarcuskanemontygreennightbloodoctaviablakepraimfayaravenravenreyesravenxreaderravenxrileyrileykanethe100wlw
Three months after the fall of Mount Weather, tensions are rising as the Ark faces new challenges. Riley Kane is determined to help forge a lasting alliance with the Grounders, but as a mysterious new technology emerges, everything changes. Her unique blood holds a critical role in this new world order, and she must decide whether to embrace the power and responsibility it brings-or risk losing everything she's fought for. Will Riley step up to the challenge, or will the weight of her destiny be too much to bear?

- I DO NOT OWN THE 100, only Riley Kane and some slight changes to the plot.

- The story WILL contain sensitive topics and other mature topics so if you cannot handle that, i advise you turn away.

S3-4
Public Domain
abbygriffinbeccapramhedabellamyblakeclarkegriffinindrakomtrikrujasperjordanjohnmurphylexakomtrikrulunakomfloukrumarcuskanemontygreennightbloodoctaviablakepraimfayaravenravenreyesravenxreaderravenxrileyrileykanethe100wlw
Table of contents

2 parts

Sign up to add Book 2: Echoes of the Blood - The 100 (Raven Reyes x Reader) to your library and receive updates
or
Content Guidelines
You may also like
Ghost Story | Bellamy Blake [2] by DeniseBritney
28 parts Complete
"Many became a ghost story, a story I remember every single day." --- Ever since the 100 landed on earth, the Grouders have been convinced that they were a treat for them all. But don't forget that it was the other way around, too. After Scarlett escaped the camp together with her boyfriend, Bellamy Blake, and her best friend, Finn Collins, the other delinquents have been taken to Mount Weather. They have no idea, until they come back and are welcomed by an ash covered ground and an almost empty drop ship. They eventually find out and they plot a rescue plan. And Scarlett? She upgraded to an even more manipulative, caring and sarcastic member of the 100. --- I highly recommend you read book one first before reading this book, if you haven't already. Everything will make more sense when you do! I only own Scarlett Griffin and her storyline. Don't steal her and her story from me. Enjoy! [Book 2] [Book 1: The Ground | Bellamy Blake]
Our New Hell (Bellamy Blake) ((the 100)) (ON HOLD FOR NOW) by JJTWD17
11 parts Complete Mature
Apollo and Luna Kane grow up in solitary their entire life. They are twins but they don't have everything in common Apollo knows how to fight but he is more of a nerd they both had to learn things about earth and other thing that they should have learned in class he loved reading about things like that he is a funny goofball. Luna hides behind her smile she hasn't cried since her mother died and she only let herself be happy around people who wouldn't see that as weakness. But in the end they had something very important in common they both would kill for each other. They thought the ark was hell but they don't know what is waiting for them on earth. Seasons 1 in progress (Warnings: Smut, Swearing, Blood, Violence)
Somewhere to Call Home [Bellamy Blake fanfic] by _random_things_
24 parts Complete
Cora was very well known in the ark, when she and 99, plus one, others were sent to the ground she struggled to adapt to the new surroundings as did everyone else. She faced the challenges of mentally self preparation of what secrets the Earth held within. 'Why was she arrested?' hardly anyone asked because they knew what Cora had done why she was locked up for nine years of her life. In the process of all she deals with the pain of new kinds of love and being able to trust people after so many years of distrust. Falling for a boy whose sister was your sell mate isn't as easy as it sounds. But this story isn't just about love, because once a hardass always a hardass. ______________
The Ground | Bellamy Blake [1] [Rewritten] by DeniseBritney
27 parts Complete Mature
REWRITTEN. 'We will fall, but we will get back up again.' --- It's been ninty-seven years since a nuclear apocalypse killed everyone one earth, leaving the planet simmering in radiation. Fortunately, there were survivors at the time of the bombs. There is now only the Ark, one station forged from the many. They were told the Earth needed another hundred years to become survivable again and man could come home, back to the ground. On the Ark, every crime, no matter how small, is punishable by death-- unless you're under eighteen, which was in the favor of the seventeen year old Scarlett Griffin, who was locked up for committing an unforgivable crime. When she get sent to Earth with ninety-nine other criminals, she's finally able to see her sister and old friends once again. Along the many new faces she meets, one caught her eyes rather quickly and she could feel herself slowly fall for him. --- ! - Swearing, lots of sarcasm, blood and Bellamy Blake. The 100. The Ground | Bellamy Blake [Rewritten] - book one. Written by DeniseBritney. ; original draft is available on my profile!
War || Bellamy Blake ¹ [ UNDER EDITING ] by stilesstilinskiibaee
25 parts Complete Mature
BOOK 1 OF 4 "Get down. Get down!" Finn said to all of us while we all hide behind a huge rock. We kept hearing noises around the forest like people walking. "We're not alone," Clarke said to us. 'Coming to earth was a bad idea' 100 kids. One mission: see if Earth is still alive. Madison Gilbert didn't expect survival to mean becoming someone she never thought she could be. From a fragile girl who lost her father... to a fierce woman ready to fight for her life. But survival isn't the only challenge. When she crosses paths with her best friend's brother, everything she knows about loyalty, trust, and love is tested. Can Madison make it on Earth-and keep her heart intact? • Best friend brother x enemies x lovers trope •age gap [ Don't own the 100 only the ones I've made. ] [ season 1 - 2] Bellamy Blake x OC [Started: December 29, 2022 ended: December 3, 2023 Editing: November, 4, 2025 Editing complete: ?? ]
Warrior by heywassupbye
31 parts Complete
A story in which a twelve year old girl on the ark, locked up for secrets she has yet to reveal, gets sent down to the mysterious earth with 99 other teenage criminals in order to see if earth is still liveable after a radioactive explosion. Maddie Steele: She may have had a rough beginning, but she will have an even harder journey. Don't let her age or appearance fool you though, because she's got a spark in her that is ready to ignite at any moment....all she needs is a lot of fire to get her going. "From the ashes we will rise" Disclaimer: I do not own any of the 100 characters, all rights go to the CW and Jason Rothenburg.
WHO IS SHE?, the 100 ¹ by bnnyskirt
23 parts Ongoing Mature
"She's a very mysterious creature, with an open smile and a closed soul." SLOWER UPDATES! season 1 - season ?? | the 100. fem!oc x male!oc | book one all best rankings: #1 - the100fanfic #1 - the100 #1 - clarkeegriffin #1 - benjaminwadsworth #1 - finncollins #1 - nightblood #1 - abbygriffin #2 - grounders #2 - marcuskane #2 - johnmurphy #3 - ocs #3 - monty #5 - explorepage #7 - theark #7 - jasperjordan started: february 23rd, 2023 published: april 30th, 2023 completed: tbd
THE FREE FALL ⇘ Bellamy Blake by ultrapunks
105 parts Ongoing Mature
they asked: ❝ DO YOU LOVE HER TO DEATH? ❞ I said: ❝ SPEAK OF HER OVER MY GRAVE AND WATCH HOW SHE BRINGS ME BACK TO LIFE. ❞ in the midst of a nation divided, two friends fallen from a satellite in the cosmos learn to throw conformity to the wind, and to love in a world of misrule. [ THE 100 - S1-S2 COMPLETE & S3 ONGOING ] BIWEEKLY UPDATES - FRIDAYS BELLAMY BLAKE x FEM!OC © copyright 2023 | ultrapunks cover by @bayports
You may also like
Slide 1 of 8
Ghost Story | Bellamy Blake [2] cover
Our New Hell (Bellamy Blake) ((the 100)) (ON HOLD FOR NOW) cover
Somewhere to Call Home [Bellamy Blake fanfic] cover
The Ground | Bellamy Blake [1] [Rewritten] cover
War || Bellamy Blake ¹ [ UNDER EDITING ] cover
Warrior cover
WHO IS SHE?, the 100 ¹ cover
THE FREE FALL ⇘ Bellamy Blake cover

Ghost Story | Bellamy Blake [2]

28 parts Complete

"Many became a ghost story, a story I remember every single day." --- Ever since the 100 landed on earth, the Grouders have been convinced that they were a treat for them all. But don't forget that it was the other way around, too. After Scarlett escaped the camp together with her boyfriend, Bellamy Blake, and her best friend, Finn Collins, the other delinquents have been taken to Mount Weather. They have no idea, until they come back and are welcomed by an ash covered ground and an almost empty drop ship. They eventually find out and they plot a rescue plan. And Scarlett? She upgraded to an even more manipulative, caring and sarcastic member of the 100. --- I highly recommend you read book one first before reading this book, if you haven't already. Everything will make more sense when you do! I only own Scarlett Griffin and her storyline. Don't steal her and her story from me. Enjoy! [Book 2] [Book 1: The Ground | Bellamy Blake]

More details