Story cover for Clash of Celestial Powers: Kei vs. Superman and Supergirl. by Lityo23
Clash of Celestial Powers: Kei vs. Superman and Supergirl.
Lityo23
  • Reads 20
  • Votes 3
  • Parts 1
  • Time <5 mins
  • Reads 20
  • Votes 3
  • Parts 1
  • Time <5 mins
Lityo23
Ongoing, First published Dec 17, 2024
action-romanceactionandadventureactionpackedclashoftitanscosmicfantasydarkfantasydramaepicfantasymythologicalfictionsci-fisciencefictionsuperherofiction
In a universe where the boundaries between realms blur, Kei, the celestial queen of ethereal light and cosmic energy, descends from her domain. Her crystalline armor shimmers with the radiance of a thousand stars, while her silver hair flows like the Milky Way itself. Legends speak of her wielding powers that can bend galaxies to her will, drawing energy from constellations long extinct.

This day, however, Kei faces an unprecedented challenge-a confrontation with Earth's greatest defenders: Superman and Supergirl.
All Rights Reserved
action-romanceactionandadventureactionpackedclashoftitanscosmicfantasydarkfantasydramaepicfantasymythologicalfictionsci-fisciencefictionsuperherofiction
Table of contents

1 part

Sign up to add Clash of Celestial Powers: Kei vs. Superman and Supergirl. to your library and receive updates
or
#9superherofiction
Content Guidelines
You may also like
Great Strike Exia - The Brave Legend by JumboWong1234
26 parts Complete
The Justice Fight , The Brave Legend of Modern Heroes. Beyond stardusts and galaxies, Amazing powers soar and radiate throughout the universe, These powers were separated to two forces, Strike, the power that comes from all things of nature, and in the light hearts of man. and Exia, a foreign power from the Mysterious Great Exia Rune of old. Each great Exia Rune shard under a Lord's possession, And from the Lords comes The Lord Exia. This, Is the emotional epic, Of how our hero -- Tenmei Akiro sacrifices himself and fight injustice with powers, EXIA and Strike, And confronts the Demon inside him, To save all, for everlasting greatness.
𝐐𝐔𝐄𝐄𝐍 𝐎𝐅 𝐓𝐇𝐄 𝐕𝐎𝐈𝐃 ; MHA by Angelbreeze-
47 parts Ongoing Mature
She descends with the fury of a thousand tempests, her three heads crowned in golden fire, her wings blotting out the stars. A force beyond gods and kings, she is the storm that bends the heavens and breaks the earth. Once a ruler of the void, now reborn in a world unprepared for her might, she seeks to reclaim her dominion. But as ancient enemies stir and new challengers rise, the Queen of the Skies must decide-will she rule with destruction, or will she forge a new legacy in a world trembling beneath her shadow?
Feathery Pillow [Hawks x Reader] by Cutiepiedoom
44 parts Complete Mature
[Completed!] You were just a quirkless girl trying to take the edge off your life with a few drinks at the bar. Due to an annoying drunkard, you found yourself saved by the number 2 hero. It was an encounter that changed your ordinary life and you don't know if it was for better or worse yet. (18+) on chapters that are smut
Legion of 8 by shelbydawnwrites
12 parts Complete
When struggling teenage artist Ella Murphy accidentally draws a mystical symbol in the margins of her book, she is transported to a different world full of superheroes and villains. Upon arrival, she falls into the apartment of Jax Legion, an underperforming superhero with a dark past. Jax and his roommates discover Ella and when she demonstrates superpowers given to her by this new world, they recruit her to help them figure out how she got in. But for now, there's a superhero competition that Jax's team must participate in to prove themselves and win a spot in the Hero Hall of Fame. Can they stay focused as they're faced with new challenges at every turn? Fans of My Hero Academia and Marvel will love this immersive action story!
Free Fall | Hawks x OC by IrisX65
34 parts Complete Mature
It was my summer vacation before my third year at UA high. I hadn't planned for anything overwhelmingly interesting to happen, but, when you decide on a whim to practice with your quirk super late out of boredom.. Well, I guess one doesn't plan these things. Who knew the Pro Hero Hawks would be the one to not only make an unexpected appearance but stay to chit chat after my rookie goof. On top of that, I didn't expect his nightly visits to become regular either. Hawks x OC This story ROUGHLY follows the anime. Timelines and other things are changed around for my own plot purposes.
POV's Age of Powers: Shards of Destiny by Lityo23
40 parts Complete
After a mysterious artifact sends you hurtling into the universe of Age of Powers, you awaken in a world where godlike beings clash, alliances are fragile, and the line between hero and villain blurs. As you navigate this new reality, you'll encounter powerful figures like Celestial Kei, Ignis, and Commander Teri while uncovering the secret that brought you here-and why your presence could tip the balance of power in ways you never imagined. After an inexplicable anomaly pulls you into the Age of Powers universe, you find yourself amidst an ongoing struggle between mighty heroes, cunning villains, and the balance of a fractured world. Forced to confront an alternate reality teeming with powers beyond comprehension, you meet Celestial Kei, Ignis, Commander Teri, and others who hold the fate of existence in their hands. As you navigate this unfamiliar yet thrilling world, your presence could tip the scales in ways no one could have foreseen.
The Eternal Conqueror (A Cosmic Sci-Fi Progression Fantasy) by alipmortuza
21 parts Ongoing Mature
When Hope Burns Out, Heroes Ignite. Planet Blackium, a planet woven into the trade and commerce of Dark Matter, relies on the Obsidian Engine as its lifeline. Over generations, the Obsidian Engine has rewritten the DNA of Blackium's inhabitants, granting them the ability to manipulate gravity. Orion Voss, son of Blackium's general-in-chief, displayed exceptional skill in gravity manipulation from a young age. He was destined to succeed his father, but that duty fell on him unexpectedly when the Starborn Empire killed his father despite his surrender to their demands, and his mother succumbed to grief. On that day, Orion vowed never to bow to anyone, no matter the cost. Now, as general-in-chief, he is determined to protect his people and, above all, his younger brother, the only family he has left, whom he loves more than anything. His resolve faces its ultimate test as the Starborn Empire demands control of the Obsidian Engine. With their lifeline at stake and the council divided, Orion is left with one question: war... or slavery? What to Expect Dark Sci-Fi Epic - A war-torn planet, brutal truths, and fading hope. Psychological Depth - Duty, sacrifice, guilt, and fierce loyalty. Cosmic Arsenal - Nexus eyes, Dark-Matter Sword, The Obsidian Engine, The Gynos, Relentless Action - Epic duels, shockwaves that shatter worlds and anime style combat Human Struggle - Grief and honor in the face of annihilation. Emotional Core - Family, friendship, and loyalty tested in the fires of war. Plot Twists that no one can predict Author's Note (for verification): This story, The Eternal Conqueror, is my original work. It is published by me on both Wattpad (@alipmortuza) and Royal Road (Orion Voss ). Any other uploads outside of these accounts are unauthorized.
phoenix ✦ k.takami (hawks) by evixtus
69 parts Complete Mature
"The sky is so tragically beautiful. A graveyard of stars." When a pro-hero passes out across the street from her bar in the middle of a spring storm, (Y/N) feels required to help thanks to her previous employment of hero work. With only her trusty cat at her side to help her fight back in case things go awry, she paces her apartment anxiously. What will happen when the man with vermillion wings wakes up? [ 1 Million Reads 9/9/2020 ] [ 2 Million Reads 6/15/2021 ] [ Republished 10/24/21 ] Highest Rankings: #1 in keigotakamixreader #1 in proherohawks #1 in bnhahawks #2 in hawksxreader #2 in keigotakamixreader
You may also like
Slide 1 of 8
Great Strike Exia - The Brave Legend cover
𝐐��𝐔𝐄𝐄𝐍 𝐎𝐅 𝐓𝐇𝐄 𝐕𝐎𝐈𝐃 ; MHA cover
Feathery Pillow [Hawks x Reader] cover
Legion of 8 cover
Free Fall | Hawks x OC cover
POV's Age of Powers: Shards of Destiny cover
The Eternal Conqueror (A Cosmic Sci-Fi Progression Fantasy) cover
phoenix ✦ k.takami (hawks) cover

Great Strike Exia - The Brave Legend

26 parts Complete

The Justice Fight , The Brave Legend of Modern Heroes. Beyond stardusts and galaxies, Amazing powers soar and radiate throughout the universe, These powers were separated to two forces, Strike, the power that comes from all things of nature, and in the light hearts of man. and Exia, a foreign power from the Mysterious Great Exia Rune of old. Each great Exia Rune shard under a Lord's possession, And from the Lords comes The Lord Exia. This, Is the emotional epic, Of how our hero -- Tenmei Akiro sacrifices himself and fight injustice with powers, EXIA and Strike, And confronts the Demon inside him, To save all, for everlasting greatness.

More details