Story cover for The Vampire's Bride [WATTY'S 2025] by GothKrispies
The Vampire's Bride [WATTY'S 2025]
GothKrispies
  • WpView
    Reads 1,935
  • WpVote
    Votes 126
  • WpPart
    Parts 27
  • WpHistory
    Time 3h 41m
  • WpView
    Reads 1,935
  • WpVote
    Votes 126
  • WpPart
    Parts 27
  • WpHistory
    Time 3h 41m
GothKrispies
Complete, First published Jan 02
curseenemiestoloversfaeriesfairytaleretellingfantasyfantasy-romancefemaleprotagonistkingdomroyaltyvampirevampirekingvampireromancewattys2025
Long ago, a family was placed under a curse that could only be broken by the heir falling in love by the rising of the full moon in their hundredth year. When Alissa is chosen as the next bride for the latest heir, she refuses to give him her heart. But fate, it seems, has other plans...

CW:  Suicide Mention | 

All Rights Reserved. This book has only been posted to Wattpad, Inkitt, MoFic, and Ritoria. If it has been found on any other site than the aforementioned, then it has been stolen. No AI has been used in the creation of this work.
All Rights Reserved
curseenemiestoloversfaeriesfairytaleretellingfantasyfantasy-romancefemaleprotagonistkingdomroyaltyvampirevampirekingvampireromancewattys2025
Table of contents

27 parts

Sign up to add The Vampire's Bride [WATTY'S 2025] to your library and receive updates
or
#271vampireking
Content Guidelines
You may also like
The Emotions Series by Fanbaby_Hp
60 parts Complete Mature
It all begins with Hope. Lies are told, people are tricked and lives are put in danger but Hope still guides the confused. Fear. One word that will make you shiver. Must a person work to help face their fear? Love comes in many forms, shapes, and colors. Will love help save them or will it tear them apart? Family can only be so close when allowed. Don't let it fool you. You might share the same blood but not the same feelings. Royalty is a curse. It turns even the closest friends away. Can the curse of Royalty be over come and friendship reunited like before or is the curse stronger then before. Lies are the game of evil. Will the lies stirred in the past ruin a perfect future or will it be forgiven and forgotten?
The Ascent by lspearson
29 parts Complete
*** This is book two in a series. YOU MUST READ The Prophecy first*** Ariella's life had changed drastically in the last month. Each day seemed to bring a new devastating truth to light. After the events of the last month she's started to change. The anger inside of her just keeps growing stronger, and as her ascent nears, her magic is becoming increasingly difficult to handle. Meanwhile, her love life has blown up in her face, and she's forced to confront her true feelings. When it comes time to make a choice, who will she choose?
Courts of Darkness and Light: The Fey Lands Saga Book 1 by AprilMotsinger
28 parts Complete Mature
Phaydra Galatine wanders into the Fey lands druing the summer Long Day festival. Realizing that she has no way of making her way back to the human world she tries to make the best of it. Prince Lian finds Phaydra on his lands. Heir to the court of light he agrees to take her in. She learns that the courts of darkness and light are under a curse. Can it be broken before the next Fey year begins? For the next fey year would set the curse in motion for another thousand years. Amidst the turmoil of the Fey lands and their courts Phaydra and Lian fall in love. How can a human and Faerie ever be together?
13 Witches Cursed ADELAIDE by ShannonHunt104
13 parts Complete Mature
A beautiful young witch is forced to pay for the sins of her parents. Cursed from birth, her upbringing, while loving and stable, is fraught with difficulty due to the circumstances of her birth and those who took offense from her mere existence. Forced into an arranged marriage, her wedding day and the days after will cause a chain of events that start to unravel the curse placed upon her. Her only hope is her traveling companion and her proxy husband. Can the curse be broken?
The Hunchback's Reluctant Bride ✔ by LynaForge
47 parts Complete Mature
Hunchbacks don't get love. They get ridicule and scorn. That suits Wyrn just fine. As the son of a warlord, he resolves to die earning his father's respect in a tournament instead. The plan backfires and he's forced to marry a princess against his will. She's 18, beautiful, and suspicious. There is no way a king would give away his ONLY child to a random man much less a hunchback. Something must be wrong with her. And so, Wyrn decides to give her back. The only problem? She won't let him.
Beautiful Beast by lucyanneholland
35 parts Complete
My name is Kalista. They call me the beast. Kalista has been cursed by a powerful sorceress and is now a prisoner in her own palace. As petals fall from an enchanted rose, her fate and the sorceress's victory draw nearer. But Kalista refuses to be defeated so easily and uses her own magic to push against the bindings. Yet what if it is not enough and the only way the curse might be shattered is through the help of another? When Arawn crosses into the beast's domain, he has one motive: revenge for his brother's death. But as he draws nearer to the beast and is surrounded by invisible servants, magical banquets, and an enchanted forest, he realizes that this beast is much more complex and much more human than he first thought. As their paths intertwine, Kalista must risk opening her heart to another, while Arawn must learn to see past his hate and prejudice. Together, they struggle against spells, wolves, and time itself to break the curse. If they fail, Kalista will fall asleep and will never again wake.
The Lottery | ONC 2020 [***ONC Shortlister!***] by KessandraRenee
12 parts Complete
In a small French kingdom where love is but a fairytale, and winning the lottery is anything but lucky, Elina Rainier finds herself the newest winner. A mysterious prince has been seeking to find himself a bride for over a century, with little success. No woman has been a good match and none who are chosen are ever heard from again. There are rumors of the fate of each bride he takes, and the people of the kingdom are left wondering if he'll ever find the perfect bride from this twisted game. Determined and unafraid, Elina knows that if she cannot win his heart, then she is the only one who can put an end to this game once and for all. But what if he isn't the monster everyone thinks he is? What if love isn't just a fairytale?
Princess Of The Underworld (remastered) by Madstarangel
18 parts Complete Mature
Princess Livana has spent her entire life locked away within the palace walls of the underworld, being prepared for her future role as queen. Despite this, she has always yearned to be free and explore the world outside, away from the palace and its responsibilities. Her parents are keen on arranging a suitable marriage for her, but Livana has her own desires. She devises a plan, even though it goes against her parents' wishes. Will Livana's plan succeed, or will she be compelled to remain within the palace walls and adhere to her parents' plan? Will she defy her parents and follow her heart, hoping for their understanding and approval? Find out by reading this story.
The Vampire King by miss__imperfection_
47 parts Complete
Highest rank - #1 in Vampire ** In a world far beyond human imagination, into the deep roots of the vampire realm he ruled. For over a century, he's known to be the most powerful king. But when a prophecy hints at his destruction, he would do anything to save his empire from crumbling. The cause? A human girl. Upon hearing about the future, he snatches her away from everything she has ever known and traps her within the cold walls of his dungeons. Could she be the cause of his destruction? Or will he destroy her first? Leaving her to pick up her own broken pieces before she can be an ounce of a threat to him. You're welcomed to explore this world where only bloodthirsty creatures , lies, betrayal, and darkness exist. But don't be surprised if you discover LOVE along the way... ** Cover by- @forcade Copyright © 2021 WARNING** Contains inappropriate content, must be 14+ to read. [Word count: 75,000 to 90,000] Enjoy.
You may also like
Slide 1 of 9
The Emotions Series cover
The Ascent cover
Courts of Darkness and Light: The Fey Lands Saga Book 1 cover
13 Witches Cursed ADELAIDE cover
The Hunchback's Reluctant Bride ✔ cover
Beautiful Beast cover
The Lottery | ONC 2020 [***ONC Shortlister!***] cover
Princess Of The Underworld (remastered) cover
The Vampire King cover

The Emotions Series

60 parts Complete Mature

It all begins with Hope. Lies are told, people are tricked and lives are put in danger but Hope still guides the confused. Fear. One word that will make you shiver. Must a person work to help face their fear? Love comes in many forms, shapes, and colors. Will love help save them or will it tear them apart? Family can only be so close when allowed. Don't let it fool you. You might share the same blood but not the same feelings. Royalty is a curse. It turns even the closest friends away. Can the curse of Royalty be over come and friendship reunited like before or is the curse stronger then before. Lies are the game of evil. Will the lies stirred in the past ruin a perfect future or will it be forgiven and forgotten?

More details