The Author's Spotlight
Ravendipity
  • Reads 945
  • Votes 225
  • Parts 31
  • Time 5h 24m
  • Reads 945
  • Votes 225
  • Parts 31
  • Time 5h 24m
Ravendipity
Ongoing, First published Jan 09
Mature
authorauthorsauthorsuniverseawardscompetitioncontestinterviewpromopromptreviewreviewstipstipsandtricksweek
Welcome to the Author's Spotlight, where we give special spotlights to authors and their works! Started by Ravendipity and Saramitra_, this spotlight book is meant to give authors promotion and recognition for their projects!
---
Marked mature for some entries being mature, but not all of them are. If any have any tws, they will be mentioned in the individual entry.
All Rights Reserved
authorauthorsauthorsuniverseawardscompetitioncontestinterviewpromopromptreviewreviewstipstipsandtricksweek
Table of contents

31 parts

Sign up to add The Author's Spotlight to your library and receive updates
or
Content Guidelines
You may also like
Slayer book awards by slayyer777
38 parts Ongoing
Open[] Judging[] Closed [✨] The Slayyer Award is all about celebrating those who go above and beyond. It's for the people who dare to dream big, take chances, and make a real difference in the world. Every year, we recognize individuals who inspire others through their hard work, creativity, and determination. This is more than just an award-it's a chance to honor those who are changing the game and making a lasting impact, one step at a time. Cover by: @HJ_Fiction Description by: @Unknown11w #1 in certificate out of 2.79k books on 15 nov #2 in slayy out of 121 books on 15 nov
It Started With You. //• rm fanfic ✔️ (under major edit) by mixxer_jixxers
51 parts Complete
"I-I could stand up myself. I don't need your help." He chuckled, "Really? You looked like you needed help." I just walked pass his shoulders, "Just stay out of my business." COMPLETED started • 26th October 2016 • ended •30.5.2017• all rights reserved.
FAQ's:About Vampires by mariacairaaaaa
22 parts Complete
THIS IS NOT MY OWN STORY/OPINION. THIS IS NOT A PLAGIARISM. I just want to collect my Vampires search here in wattpad. Thank you. Salamat. Sukran. Gomawo. Xie-xie. Arigato. Gracias.
Candlelight Awards || OPEN & JUDGING by Ravendipity
12 parts Ongoing
Looking for exposure for your story and fair, detailed reviews? Look no further than the Candlelight Awards, an awards book open to all writers regardless of genre or length. That's right: even stories with just ONE chapter can apply. Status: OPEN & Judging. Few categories left. What to expect: - Quick & easy payments - Almost everyone can apply - Fair judging - Unique prizes - Plenty of categories - And more!
Padauk Mini Awards || COMPLETED ✔️ by Ravendipity
25 parts Complete
|| COMPLETED || Tired of waiting a million years for award results to come out? Look no further than the Padauk Mini Awards, a small awards contest meant to be judged fast but still offer unique prizes and a fair experience to everyone. Any book of all length and genres can apply since there are plenty of mini categories to choose from! What this includes: - Fair judging (only one judge to keep it balanced) - Communicative host - Unique prizes - Accessible to most writers - Opportunities for small writers to grow
Eternal Kings by MohammedAnisZerarka
20 parts Ongoing Mature
Imagine, if your dream, your greatest wish, your deepest desire, the future you fantasized about, and poured all of your soul to realize, suddenly gets crushed before your eyes, shattered in pieces, leaving you empty, lifeless, with no reason to breathe, for Eternity What would you do, would you decide to burn the world, or yourself ?
INSTA-BAE (kjn°kth) by Phiangbugarets
107 parts Complete
Soloist' social media life.
Read-for-Read Book club (closed) by Kanhakisakhi
105 parts Ongoing
Just published a new book and want some readers? Want some viewers and reads for your new book? Need constructive comments and suggestions for your book? Are you a new writer and are struggling to have some readers of your book? This book club is perfect for you! [Note: You can also join if you are just a reader too!]
Fifteenth by Psyckizz
53 parts Ongoing
Random Poems. -Uncharted domain-
My drawings/artwork by MYKittyIsLily
27 parts Ongoing
My drawing and other art things I did! Please tell me if you like them!
You may also like
Slide 1 of 10
Slayer book awards cover
It Started With You. //• rm fanfic ✔️ (under major edit) cover
FAQ's:About Vampires cover
Candlelight Awards || OPEN & JUDGING cover
Padauk Mini Awards || COMPLETED ✔️ cover
Eternal Kings cover
INSTA-BAE (kjn°kth) cover
Read-for-Read Book club (closed) cover
Fifteenth cover
My drawings/artwork cover

Slayer book awards

38 parts Ongoing

Open[] Judging[] Closed [✨] The Slayyer Award is all about celebrating those who go above and beyond. It's for the people who dare to dream big, take chances, and make a real difference in the world. Every year, we recognize individuals who inspire others through their hard work, creativity, and determination. This is more than just an award-it's a chance to honor those who are changing the game and making a lasting impact, one step at a time. Cover by: @HJ_Fiction Description by: @Unknown11w #1 in certificate out of 2.79k books on 15 nov #2 in slayy out of 121 books on 15 nov

More details