SUPLLIER WALLPAPER VINYL ROLL BERKUALITAS
wallpaper03
  • Reads 2
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 2
  • Votes 0
  • Parts 1
  • Time <5 mins
wallpaper03
Ongoing, First published Jan 13
distributorwallpapervinylpenyediawallpapermotifpenyediawallpapervinylrollsupplairwallpapervinylrollwallpapermalangidwallpapervinylroll
Anda Ingin ruangan terlihat lebih elegan dan unik? Wallpaper Malang ID solusinya, kami penyedia wallpaper vinyl dengan berbagai motif untuk dekorasi yang dapat mengubah tampilan ruangan anda menjadi lebih elegan.

Wallpaper Malang id Sebagai supplier wallpaper untuk proyek besar dan supplier wallpaper vinyl roll yang pastinya harga terjangkau. Sebagai distributor wallpaper vinyl terpecaya anda tidak perlu merasa khawatir akan kualitas yang kami tawarkan, serta harga yang lebih terjangkau. 

paket hemat wallpaper vinyl roll 
Harga : Rp190.000 - Rp290.000/roll 
sudah termasuk jasa pemasangan dan free lem area Kota Malang, minimal pemasangan 5 roll

Percayakan kebutuhan dekorasi anda pada supplier wallpaper vinyl terpercaya di Malang.Jadikan setiap ruangan Anda lebih personal dan menawan dengan layanan kami.

WhatsApp:087803144655
Instagram: wallpapermalang.id
All Rights Reserved
distributorwallpapervinylpenyediawallpapermotifpenyediawallpapervinylrollsupplairwallpapervinylrollwallpapermalangidwallpapervinylroll
Table of contents

1 part

Sign up to add SUPLLIER WALLPAPER VINYL ROLL BERKUALITAS to your library and receive updates
or
#52wallpapermalangid
Content Guidelines
You may also like
Our angel by Naiwrites2u
84 parts Complete
𝐀𝐫𝐢𝐚𝐧𝐧𝐚. For 11 years of her life Arianna has been pushed, beaten and forced to become a top assassin. At the age of 5, little Arianna was kidnapped after witnessing the death of her mother. 𝐀𝐫𝐢𝐚𝐧𝐧𝐚 𝐌𝐨𝐫𝐞𝐭𝐭𝐢. Missing daughter of notorious mafia don Stefano Moretti. Arianna remembers everything. She knows everything about her family (well not everything). Find out what happens when Arianna is thrown back into the arms of her father and brothers. Follow her story of lies, adventure and death as she re discovers her love for her family. Throw in a mysterious boy and overprotective brothers, guns, death and much more in her journey to finding herself.
SHORT NOVEL 🔞❗ by Alitaambition
19 parts Ongoing
Unappreciated for under18
Tensura: The Abyss Demon by Wahabadebanjo
82 parts Complete
What if Rimuru was instead reborn as a primordial demon; the strongest in combat and intelligence. He reincarnated just before Star king dragon Veldanava created the omniverse; it was nothing but a void, his soul being exposed just a little to turn null made his soul undergo a change. Making him an individual with a high evolutionary potential
The Hunter's Gonna Lay Low [Part 2] by LucidTheReader
146 parts Ongoing
This is the Part 2 of "The Hunter's gonna lay low" since I can't publish more than 200 parts in one story.. &gt; The Hunter's Gonna Lay low written by Baek Sam
Homelander: New Legacy by Dragon155913
199 parts Ongoing
When Roger, an ordinary man with an extraordinary heart, is suddenly reincarnated into the body of Homelander, the world's most powerful and controversial hero, he faces an unimaginable challenge. Now endowed with not only Homelander's immense abilities but also Superman's legendary powers, Roger is both shocked and overwhelmed. What will his future hold???
Hero Hunter: Izuku Yagi [opm x mha] by ManLikeETO
52 parts Ongoing
In a world where 80% of the population has quirks the other 20% doesn't. izuku yagi, the son of the number one hero was one of those 20%. Izuku Yagi's life was a nightmare, filled with bullying at school from his supposed friend bakugo and his sister izumi yagi and neglect from his family, including his father, All Might. Finding solace in the teachings of Silverfang, an S-class martial artist, Izuku transformed from a weak boy into a powerful, cold fighter. His impressive performance at the UA High School entrance exam was sabotaged by All Might, crushing his dreams. Betrayed and disillusioned, Izuku became the Hero Hunter, seeking to expose the corruption in hero society and exact revenge on those who wronged him. warning: mature language will be used *i do not own one punch man or my hero academia* *i do not own any of these characters*
The Flash: The Fastest Man Alive (Male Reader Insert) by Fredbot
92 parts Ongoing
Y/N L/N was always a believer in the impossible, but he never suspected he would become the impossible. When a fateful lightning strike gives Y/N the power to move at super fast speeds, he must learn to step up as a hero against similarly affected people, ones whose agendas pose a threat to the world. Finding a team to call family, Y/N learns the power of speed, responsibility, teamwork, and love. He is the fastest man alive. He is the Flash. The Flash and other properties are under the ownership of DC and Warner Bros. I did not intend on using this story for revenue or monetary gain. All rights reserved to their original owners.
𝑻𝒉𝒆 𝑺𝒆𝒄𝒓𝒆𝒕 𝒐𝒇 𝑬𝒗𝒊𝒍 by morA_nyein
25 parts Ongoing
စုံထောက်မလေး နဲ့ Mafia ဂိုဏ်းချုပ် တို့ရဲ့ Married Life Dark Romance ဇာတ်လမ်း 9.11.2024
333 ONLY HALF DEVIL by roserose943030
20 parts Ongoing
الشقة 333 "نعم كانت هي.. كانت نفس الشقة التي بدأ بها عذابي.. هكذا وقفت امامها ذلك اليوم قلبي ينبض بجنون ابحث عن الحب الذي لن اجده فيها يوماً .. بل وجدت بدله نصف الشيطان الذي كنت انا احمل نصفه الاخر.. اجل كانت حياته بين يدي وكان موتي بين يديه سلسلة وحوش بشرية الكاتبة : أصالة روز
الادعج " قاع الظلام " by zahralsadi
43 parts Complete
الأدعج" قـاع الظلام " تنـتظـِركم لـيالـي قاسية وعيـون لاتنـّام وأيـام سوداوية فـْي أعـماق قــاع الظلام هـيا يـا رِفـاق انـتـّزعو ثـُوب النجاة لـنغوص مـعـاً فــّي حكايـة الـقتـلِ والدماء لنـُكـشف الالـغـاز تاره تاره بهـَدوء وعـقل دهـاءِ . باللهجة العراقية رواية حقيقية بقلمَـي زهراء الساعدي توضيـح لا احلل أخذ الروايـة ونشرها إطلاقًا
You may also like
Slide 1 of 10
Our angel cover
SHORT NOVEL 🔞❗ cover
Tensura: The Abyss Demon cover
The Hunter's Gonna Lay Low [Part 2] cover
Homelander: New Legacy cover
Hero Hunter: Izuku Yagi [opm x mha] cover
The Flash: The Fastest Man Alive (Male Reader Insert) cover
𝑻𝒉𝒆 𝑺𝒆𝒄𝒓𝒆𝒕 𝒐𝒇 𝑬𝒗𝒊𝒍 cover
333 ONLY HALF DEVIL cover
الادعج " قاع الظلام " cover

Our angel

84 parts Complete

𝐀𝐫𝐢𝐚𝐧𝐧𝐚. For 11 years of her life Arianna has been pushed, beaten and forced to become a top assassin. At the age of 5, little Arianna was kidnapped after witnessing the death of her mother. 𝐀𝐫𝐢𝐚𝐧𝐧𝐚 𝐌𝐨𝐫𝐞𝐭𝐭𝐢. Missing daughter of notorious mafia don Stefano Moretti. Arianna remembers everything. She knows everything about her family (well not everything). Find out what happens when Arianna is thrown back into the arms of her father and brothers. Follow her story of lies, adventure and death as she re discovers her love for her family. Throw in a mysterious boy and overprotective brothers, guns, death and much more in her journey to finding herself.

More details