PENYEDIA WALLPAPER VINYL BERKUALITAS DI MALANG
wallpaper03
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
wallpaper03
Ongoing, First published 5 days ago
1 new part
distributorwallpapervinyljasapemasanganwallpaperpenyediawallpapervinylwallpapermalangidwallpapermotifmewahwallpapervinylberkualitas
Anda bingung merubah tampilan ruangan agar terlihat lebih unik dan menarik? Wallpaper Malang ID solusinya, kami menawarkan wallpaper vinyl dengan motif mewah yang dapat membuat ruangan anda menjadi lebih menarik dengan berbagai motif unik yang dapat Anda jadikan pilihan.

Wallpaper Malang ID sebagai penyedia wallpaper vinyl untuk ruang kerja dan keluarga, kami tawarkan jasa pemasangan wallpaper terpecaya di Malang yang pastinya Harga terjangkau. Sebagai distributor wallpaper vinyl untuk proyek besar, Anda tidak perlu merasa khawatir akan kualitas yang kami tawarkan, serta harga yang lebih terjangkau. 

paket hemat wallpaper vinyl roll 
Harga : Rp190.000 - Rp290.000/roll 
sudah termasuk jasa pemasangan dan free lem area Kota Malang, minimal pemasangan 5 roll

Tunggu apa lagi segera cari  penyedia wallpaper vinyl untuk kebutuhan dekorasi anda. Jadikan setiap ruangan Anda lebih menarik dengan wallpaper vinyl dari kami.

WhatsApp:087803144655
Instagram: wallpapermalang.id
All Rights Reserved
distributorwallpapervinyljasapemasanganwallpaperpenyediawallpapervinylwallpapermalangidwallpapermotifmewahwallpapervinylberkualitas
Table of contents

1 part

Sign up to add PENYEDIA WALLPAPER VINYL BERKUALITAS DI MALANG to your library and receive updates
or
#16wallpapermalangid
Content Guidelines
You may also like
Hero Hunter: Izuku Yagi [opm x mha] by ManLikeETO
50 parts Ongoing
In a world where 80% of the population has quirks the other 20% doesn't. izuku yagi, the son of the number one hero was one of those 20%. Izuku Yagi's life was a nightmare, filled with bullying at school from his supposed friend bakugo and his sister izumi yagi and neglect from his family, including his father, All Might. Finding solace in the teachings of Silverfang, an S-class martial artist, Izuku transformed from a weak boy into a powerful, cold fighter. His impressive performance at the UA High School entrance exam was sabotaged by All Might, crushing his dreams. Betrayed and disillusioned, Izuku became the Hero Hunter, seeking to expose the corruption in hero society and exact revenge on those who wronged him. warning: mature language will be used *i do not own one punch man or my hero academia* *i do not own any of these characters*
SHORT NOVEL 🔞❗ by Alitaambition
20 parts Ongoing
Unappreciated for under18
𝘔𝘪𝘯𝘥 𝘎𝘢𝘮𝘦𝘴 🦑 Thanos x Reader by Av1ce_Doe
15 parts Ongoing
230 x 069 If money and success were a test, Y/N had failed-at least by the world's unforgiving standards. In a harsh, cutthroat reality where wealth and power defined worth, she had always been on the losing side, scraping by in the shadows of society. Yet here she was, thrown into a twisted arena where survival hinged not on financial prowess, but on wit, grit, and sheer willpower.
Homelander: New Legacy by Dragon155913
195 parts Ongoing
When Roger, an ordinary man with an extraordinary heart, is suddenly reincarnated into the body of Homelander, the world's most powerful and controversial hero, he faces an unimaginable challenge. Now endowed with not only Homelander's immense abilities but also Superman's legendary powers, Roger is both shocked and overwhelmed. What will his future hold???
𝑻𝒉𝒆 𝑺𝒆𝒄𝒓𝒆𝒕 𝒐𝒇 𝑬𝒗𝒊𝒍 by morA_nyein
24 parts Ongoing
စုံထောက်မလေး နဲ့ Mafia ဂိုဏ်းချုပ် တို့ရဲ့ Married Life Dark Romance ဇာတ်လမ်း 9.11.2024
The Flash: The Fastest Man Alive (Male Reader Insert) by Fredbot
89 parts Ongoing
Y/N L/N was always a believer in the impossible, but he never suspected he would become the impossible. When a fateful lightning strike gives Y/N the power to move at super fast speeds, he must learn to step up as a hero against similarly affected people, ones whose agendas pose a threat to the world. Finding a team to call family, Y/N learns the power of speed, responsibility, teamwork, and love. He is the fastest man alive. He is the Flash. The Flash and other properties are under the ownership of DC and Warner Bros. I did not intend on using this story for revenue or monetary gain. All rights reserved to their original owners.
الادعج " قاع الظلام " by zahralsadi
43 parts Complete
الأدعج" قـاع الظلام " تنـتظـِركم لـيالـي قاسية وعيـون لاتنـّام وأيـام سوداوية فـْي أعـماق قــاع الظلام هـيا يـا رِفـاق انـتـّزعو ثـُوب النجاة لـنغوص مـعـاً فــّي حكايـة الـقتـلِ والدماء لنـُكـشف الالـغـاز تاره تاره بهـَدوء وعـقل دهـاءِ . باللهجة العراقية رواية حقيقية بقلمَـي زهراء الساعدي توضيـح لا احلل أخذ الروايـة ونشرها إطلاقًا
Our angel by Naiwrites2u
71 parts Ongoing
𝐀𝐫𝐢𝐚𝐧𝐧𝐚. For 11 years of her life Arianna has been pushed, beaten and forced to become a top assassin. At the age of 5, little Arianna was kidnapped after witnessing the death of her mother. 𝐀𝐫𝐢𝐚𝐧𝐧𝐚 𝐌𝐨𝐫𝐞𝐭𝐭𝐢. Missing daughter of notorious mafia don Stefano Moretti. Arianna remembers everything. She knows everything about her family (well not everything). Find out what happens when Arianna is thrown back into the arms of her father and brothers. Follow her story of lies, adventure and death as she re discovers her love for her family. Throw in a mysterious boy and overprotective brothers, guns, death and much more in her journey to finding herself.
My Wild Professor by Irishsanxie
29 parts Ongoing
Genre:Romance, Spg Plsss vote my story...
Tensura: The Abyss Demon by Wahabadebanjo
78 parts Complete
What if Rimuru was instead reborn as a primordial demon; the strongest in combat and intelligence. He reincarnated just before Star king dragon Veldanava created the omniverse; it was nothing but a void, his soul being exposed just a little to turn null made his soul undergo a change. Making him an individual with a high evolutionary potential
You may also like
Slide 1 of 10
Hero Hunter: Izuku Yagi [opm x mha] cover
SHORT NOVEL 🔞❗ cover
𝘔𝘪𝘯𝘥 𝘎𝘢𝘮𝘦𝘴 🦑 Thanos x Reader cover
Homelander: New Legacy cover
𝑻𝒉𝒆 𝑺𝒆𝒄𝒓𝒆𝒕 𝒐𝒇 𝑬𝒗𝒊𝒍 cover
The Flash: The Fastest Man Alive (Male Reader Insert) cover
الادعج " قاع الظلام " cover
Our angel cover
My Wild Professor cover
Tensura: The Abyss Demon cover

Hero Hunter: Izuku Yagi [opm x mha]

50 parts Ongoing

In a world where 80% of the population has quirks the other 20% doesn't. izuku yagi, the son of the number one hero was one of those 20%. Izuku Yagi's life was a nightmare, filled with bullying at school from his supposed friend bakugo and his sister izumi yagi and neglect from his family, including his father, All Might. Finding solace in the teachings of Silverfang, an S-class martial artist, Izuku transformed from a weak boy into a powerful, cold fighter. His impressive performance at the UA High School entrance exam was sabotaged by All Might, crushing his dreams. Betrayed and disillusioned, Izuku became the Hero Hunter, seeking to expose the corruption in hero society and exact revenge on those who wronged him. warning: mature language will be used *i do not own one punch man or my hero academia* *i do not own any of these characters*

More details