Story cover for Crown of Thorns | ONC 2025 Longlister ✓ by dcbolton
Crown of Thorns | ONC 2025 Longlister ✓
dcbolton
  • WpView
    Reads 276
  • WpVote
    Votes 84
  • WpPart
    Parts 20
  • WpHistory
    Time 2h 56m
  • WpView
    Reads 276
  • WpVote
    Votes 84
  • WpPart
    Parts 20
  • WpHistory
    Time 2h 56m
dcbolton
Complete, First published Feb 02
Mature
bloodandgoredarkfantasyfantasyfantasy-romancefemalemaincharacterfirstpersonfoundfamilygoodvsevilhalf-elfhighfantasymagicmanipulationmaturethemesmythicalcreaturesonc2025opennovellacontest2025resistanceswordfightingtragedy
*UPDATED DESCRIPTION COMING SOON*

In a world where humans and other species coexist, Saeris falls prey to the Chosen, a ruthless faction bent on domination after shattering the fragile peace in the land. Rescued and healed by the Dawnbringers, Saeris vows to destroy the Chosen and their leader who wields an ancient artifact to fuel their reign of terror.

As the war rages on, Saeris must confront painful truths about her past, face the beings she's been trained to destroy, and make choices that could tear apart everything she's fighting for. In a world on the brink of collapse, the path to peace is uncertain, and nothing comes without sacrifice.

TRIGGER WARNING: descriptions of blood and gore, tragic loss, killing, and consensual sex.

•••

Start: February 2, 2025
End: April 17, 2025

Word count: 37,049


© D. C. Bolton 2025

© All Rights Reserved
All Rights Reserved
bloodandgoredarkfantasyfantasyfantasy-romancefemalemaincharacterfirstpersonfoundfamilygoodvsevilhalf-elfhighfantasymagicmanipulationmaturethemesmythicalcreaturesonc2025opennovellacontest2025resistanceswordfightingtragedy
Table of contents

20 parts

Sign up to add Crown of Thorns | ONC 2025 Longlister ✓ to your library and receive updates
or
Content Guidelines
You may also like
The Skeleton Queen by Carlos_G_Peralta
41 parts Complete Mature
In the lands of Europa, the unpredictable magic of necromancy had been banned by every kingdom. However, a rebellious queen in Span defies the edict by summoning an army of the undead to wreak havoc on the living. Her wicked magic also siphons the nourishment of Europa's fertile lands. With urgency, the kingdoms send their finest warriors and mages to kill the necromancer noble...only for them to never return. The desperation has the kingdom of Engla send their last two hopes: Garth, a battle-hardened knight and William, a blind but powerful bard with a golden voice. During their journey, personal motivations are revealed. One seeks glory, while the other seeks vengeance. Will their goals be enough to help them overcome the Skeleton Queen or will they also fall to her magic? 2nd Place Winner in Fantasy; 2023 Lovely Valentine Awards ***Cover art done by @AdrielleReina
RISEN | ONC 2024 by hendre_writes
20 parts Complete
[5X FEATURED STORY] A boy born with Serpentblood. An exiled dwarf in pursuit of his destiny. A she-elf guided by a religious prophecy. Together, they must rise to find the coveted Light of the World, a saviour who promises to tip the scale of waging Spiritual War in their favour before the Dragoness and her serpent army condemn their kingdom to eternal damnation. *** After years of enslavement by the Dragoness, a witch set on converting his home to worship her dark lord, sixteen-year-old Heran, a half-dragon, embarks on a quest to find the Light of the World, the answer to a mysterious prophecy that promises the kingdom of Roxundam's freedom. Allied with the unpredictable alchemist Zonis, a young dwarf charting their course across the seas in his boat, The Lillycove, and the alluring Ackie, a she-elf holding the vital location to their destined saviour, Heran traverses the beautiful yet harrowing world of the Southern Isles and beyond. With a political uprising threatening to tear Roxundam apart in his absence and a dragon army hunting him, Heran's journey will invite consequences and sacrifices that will forever change his company and the fabric of their world. To defeat the darkness, he must become the light. *** (V1) - Participant in the 2024 Open Novella Contest | Round 1 Qualifier | Round 1 Winner | Round 2 Qualifier | Round 2 Winner | Longlister | Shortlister Featured by @Fantasy in their Epic Fantasy Reading List ✨June 2024 ✨ Featured by @ShortStory in their Novelettes Reading List ✨September 2024✨ Featured by @ShortStory in their Short Story Spotlight Reading List ✨March 2025✨ Featured by @Ambassadors in their Shorts and Poems Reading List ✨September 2025✨ Features by @Fantasy in their Mythical Creatures Reading List ✨October 2025✨ Prompt #21 - A Dragon, an Elf, and a Dwarf embark on a quest to find the lost heir to the kingdom. First Draft - February 2024 - April 2024 Cover - Designed in Canva (Wattpad Use Only)
The Scavengers of Finhensh by akku6884
12 parts Ongoing Mature
In a world, where the sky has fractured under the rage of a dying sun, half ablaze with furious light, the other half shrouded in an unnatural twilight, the country of Fihensh teeters on the precipice of chaos. Two siblings, bound and broken by fate , must rediscover the fragile threads of their shattered trust. Driven by a ravenous hunger for forbidden knowledge, kasik, an amateur thief, must infiltrate the revered Citadel , a bastion of power where magic is controlled by those in power. Meanwhile, Shivi must navigate a treacherous labyrinth of shifting alliances, backstabbing rivals, and the insidious whispers of ancient evils. Each sibling stood at a precipice. Surrender to the temptations of power, and risk becoming a puppet of the very forces they sought to understand. Or they could defy the odds, break the chains that bound their souls, and shatter the oppressive society that threatened to consume them all."
Dawn of Dilemmas: The Blood Covenant by lucien_kodicai
11 parts Ongoing Mature
"In this world, would the blood we shared together change everything?" Welcome to Remotiona, where the boundaries between fantasy and reality blur, and where hope is both fragile and powerful. Here, dreams can be stolen before they even begin. Among the lost is Vivianne, an elven mother scarred by cruel captivity, fiercely protecting her spirited daughter, Seirel, in the once-beautiful Domain of Erz'kapril-now a shadow of its former self. Their lives take an unexpected turn when they cross paths with Jay, a human with no memory of his past but an undeniable connection to Vivianne's own. Together, they embark on a journey that rekindles hope in her fractured heart and offers Seirel the protection she's longed for. Bound by a mysterious resistance movement known as the Covelfeers, Vivianne and Jay uncover truths buried deep within their shared history, guided by the spectral voice of Vivianne's mother, Natalie-a legendary rebel who left behind a legacy of courage. As "Alpha Children," their fates are woven into a prophecy that could reshape their world. Amid fiery battles, whispered secrets, and the stirring warmth of love rediscovered, they must face their scars and summon the strength to challenge Erz'kapril's tyrannical rule. Will their unbreakable bond be enough to light the way to freedom, or will the shadows of their past consume them?
Fated by JaideHarley
6 parts Complete Mature
****COMPLETED**** "You're driving me crazy," I growled, dropping my hand down to her waist then around to her lower back, sucking her earlobe into my mouth and dragging my teeth along it. She groaned and dropped her head back against the wall. Her sounds were intoxicating. I could smell how much she was responding to me and it brought my need for her out even more. I cupped her cheek and brought my lips over to hers, just barely brushing against them. "Addie," I whispered against her mouth, threading my hand through her hair. ... Addie has been abducted and thrown into the supernatural world. She discovers vampires have kidnapped her to manipulate an Alpha werewolf. Not just any werewolf, her mate. Or so the guy in the cell next to her says. Problem is, they've underestimated her because she's human. She's going to show them how much damage a human can do. Alpha Xander's past comes back to haunt him and his Beta has been missing for two days. Xander is finally contacted and offered a deal: his life for his Beta's and the mate he has yet to meet. He's been waiting his whole life to meet his mate and will do anything to keep her safe. Except she doesn't need as much help as he thought she might. #2 in pack on 5/22 #1 in mates 6/22 WARNING This is an adult book. It will have mature language and scenes.
Never Green | ONC 2023 by elmaloney
25 parts Complete Mature
ONC Shortlister 2023! There are few rules in the Kingdom of Kadotaru, and punishment is not kind, even for the young prince who wishes he was anybody else. Tied to the crown, to his family, to his kingdom, there isn't much he can do. He isn't born to bear the crown, to rule over all the creatures of Kadotaru, but it still haunts him. He never thought to break a rule, there was too much fear deep in his heart. He never thought to break any rules, until she was able to see him. Humans. Humans don't have true sight. They aren't seers, or creatures of Kadotaru. So why can she see him? Why does she reach out to help him? And why did he have to break Kadotaru's most sacred rule? ------------------------------------------------------- This novella will include extreme violence. There will be warnings at the beginning of the chapters that include this show of brutality, but do not reach this novella if you do not wish to read horrific scenes. For the Open Novella Contest 2023 | Cover designed by me | Prompt 62 Word Count - 38,637 RANKINGS: #44 in High Fantasy - 27/04/2023 #90 in Fae - 10/02/2023 #79 in Dark Fantasy - 10/02/2023 #09 in opennovellacontest2023 - 10/02/2023 © elmaloney 2023 | all rights reserved
Icebound by Lizzyy_L
5 parts Ongoing Mature
For 250 years, the world has been buried beneath ice and shadow. The Shroud swallowed the sky, putting the planet into an endless winter. The sun is nothing but a myth, and the last of humanity clings to survival in the underground cities. So does Odette Voss until the fall of Aetheris. Odette barely escapes, forced onto the frozen surface she's only heard horror stories about. The cold is brutal. The ruins are haunted by creatures that should not exist. And the few survivors left will do anything to stay alive but so will she. The only things keeping her going are the thoughs about her brother and the safe haven, Aurelia. If Kieran survived, she'll find him. If Aurelia is real, she'll reach it. And no matter what lurks in the ice, she'll be ready.
𝐓𝐇𝐄 𝐋𝐎𝐒𝐓 𝐀𝐍𝐃 𝐓𝐇𝐄 𝐂𝐇𝐎𝐒𝐄𝐍 ᴀ ᴋɪɴɢ ᴀʀᴛʜᴜʀ ʀᴇᴛᴇʟʟɪɴɢ ✔ by HayleyLHeureux
22 parts Complete Mature
|LONG LISTED IN THE OPEN NOVELLA CONTEST 2022| Blood. Peace. Betrayal. And Death comes knocking on Camelot, Londinium, and England's front door. A great war rages from the North, threatening Camelot's and Londinium's existence. A legend passes through Camelot, whispering a prophecy that a man would pull the sword from the stone. But what if the prophecy was forged falsely? What if a woman pulled Excalibur from the stone? Axel Embers the last bloodline heir of Uther Pendragon, must forge an alliance within her country in order to stop the war that rages from the North. Along the way with slaying things darker than her world, that threaten her way. What if she told you this was a war that one woman could win? That this war was a battle of inner demons that come to life. Prompt 52 of the ONC Started: February 3rd, 2022. Finished: April 29, 2022. |1x Featured on Wattpad's Mythandlegend!| AMBYS Top Picks Winner! Best ranks: 1st in sword in the stone, August 31.
You may also like
Slide 1 of 8
The Skeleton Queen cover
RISEN | ONC 2024 cover
The Scavengers of Finhensh cover
Dawn of Dilemmas: The Blood Covenant cover
Fated cover
Never Green | ONC 2023 cover
Icebound cover
𝐓𝐇𝐄 𝐋𝐎𝐒𝐓 𝐀𝐍𝐃 𝐓𝐇𝐄 𝐂𝐇𝐎𝐒𝐄��𝐍 ᴀ ᴋɪɴɢ ᴀʀᴛʜᴜʀ ʀᴇᴛᴇʟʟɪɴɢ ✔ cover

The Skeleton Queen

41 parts Complete Mature

In the lands of Europa, the unpredictable magic of necromancy had been banned by every kingdom. However, a rebellious queen in Span defies the edict by summoning an army of the undead to wreak havoc on the living. Her wicked magic also siphons the nourishment of Europa's fertile lands. With urgency, the kingdoms send their finest warriors and mages to kill the necromancer noble...only for them to never return. The desperation has the kingdom of Engla send their last two hopes: Garth, a battle-hardened knight and William, a blind but powerful bard with a golden voice. During their journey, personal motivations are revealed. One seeks glory, while the other seeks vengeance. Will their goals be enough to help them overcome the Skeleton Queen or will they also fall to her magic? 2nd Place Winner in Fantasy; 2023 Lovely Valentine Awards ***Cover art done by @AdrielleReina

More details