VENDOR JASA PASANG WALLPAPER MALANG
wallpaper03
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
wallpaper03
Ongoing, First published Feb 18
1 new part
jasapasangcustomjasapasangvinyljasapemasanganwallpaperpakethematcustompakethematvinylpaketpemasangancustompaketpemasanganvinyltukangpasangwallpapervendorwallpaperberkualitasvendorwallpaperterpecayawallpapercustomwallpapermalangidwallpapervinyl
Bingung mengubah tampilan ruangan Anda menjadi lebih menarik? Wallpaper Malang ID solusinya. Wallpaper Malang ID menawarkan jasa pemasangan wallpaper untuk membantu kebutuhan mengubah tampilan ruangan Anda. Selain itu, kami memiliki tukang pasang wallpaper yang sudah berpengalaman di bidang interior membuat hasil pemasangan lebih rapi dan halus serta harga yang terjangkau.

Wallpaper Malang ID juga sebagai Vendor wallpaper terpercaya dan berkualitas di Malang. Kami siap membantu Anda mengubah tampilan ruangan dengan berbagai pilihan desain dan motif unik, yang bisa disesuaikan dengan selera Anda.

Detail rincian wallpaper custom :
Bahan : vinyl
Tekstur : kulit jeruk
Minimal pemasangan : 7m²
Paket hemat : wallpaper custom free lem + jasa pemasangan Rp. 220.000/m²

Detail Rincian Wallpaper Vinyl :
Bahan Vinyl
Minimal Pemasangan 5 Roll
Paket hemat wallpaper vinyl free lem + jasa pasang : Rp. 190.000 - 290.000/Roll

Tunggu apa lagi! Wujudkan ruangan rumah impian anda dengan vendor jasa pasang wallpaper di Malang.

Hubungi kami di : 
WhatsApp : 087803144655 
Instagram : wallpapermalang.id

#wallpapermalangid
#jasapemasanganwallpaper
#tukangpasangwallpaper
#vendorwallpaperterpecaya
#vendorwallpaperberkualitas
#wallpapervinyl
#paketpemasanganvinyl
#jasapasangvinyl
#pakethematvinyl
#jasapasangcustom
#pakethematcustom
#paketpemasangancustom
#wallpapercustom
All Rights Reserved
jasapasangcustomjasapasangvinyljasapemasanganwallpaperpakethematcustompakethematvinylpaketpemasangancustompaketpemasanganvinyltukangpasangwallpapervendorwallpaperberkualitasvendorwallpaperterpecayawallpapercustomwallpapermalangidwallpapervinyl
Table of contents

1 part

Sign up to add VENDOR JASA PASANG WALLPAPER MALANG to your library and receive updates
or
#11wallpapervinyl
Content Guidelines
You may also like
Our angel by Naiwrites2u
84 parts Complete
𝐀𝐫𝐢𝐚𝐧𝐧𝐚. For 11 years of her life Arianna has been pushed, beaten and forced to become a top assassin. At the age of 5, little Arianna was kidnapped after witnessing the death of her mother. 𝐀𝐫𝐢𝐚𝐧𝐧𝐚 𝐌𝐨𝐫𝐞𝐭𝐭𝐢. Missing daughter of notorious mafia don Stefano Moretti. Arianna remembers everything. She knows everything about her family (well not everything). Find out what happens when Arianna is thrown back into the arms of her father and brothers. Follow her story of lies, adventure and death as she re discovers her love for her family. Throw in a mysterious boy and overprotective brothers, guns, death and much more in her journey to finding herself.
From Eden | K. Dae-ho by -dylancore
30 parts Ongoing
"I didn't really want to believe him when he said these games would kill us." Squid Game Season 2 Kang Daeho (player 388) © -dylancore
The lost mafia princess by marvelsbestie1
46 parts Ongoing
The Giovanni's are the Italian Mafia. It is the most powerful mafia. For 8 generations the family have been trying to have a princess in the family but have been unsuccessful. That is until Alina Giovanni and her twin Adrian were born. Due to Alina being born she was target for the other mafia's especially the Russians who hated the Italians due to their success. Alina is taken by them and brought up in terrible conditions. The whole family was heartbroken but never gave up trying to find her. With 6 brothers and parents never forgetting her they were sure to get her back. They weren't the most powerful mafia for nothing. How long do you think it would take to get her back and make the family whole again, if that was even possible? Would things turn out ok in the end? Cover by @prielle on Pinterest
𝐉𝐔𝐒𝐓 𝐔𝐒 by -GEEKER
26 parts Ongoing
❝𝐈𝐓𝐒 𝐉𝐔𝐒𝐓 𝐔𝐒 𝐀𝐆𝐀𝐈𝐍𝐒𝐓 𝐓𝐇𝐄 𝐖𝐎𝐑𝐋𝐃.❞
𝑻𝒉𝒆 𝑺𝒆𝒄𝒓𝒆𝒕 𝒐𝒇 𝑬𝒗𝒊𝒍 by morA_nyein
29 parts Ongoing
စုံထောက်မလေး နဲ့ Mafia ဂိုဏ်းချုပ် တို့ရဲ့ Married Life Dark Romance ဇာတ်လမ်း 9.11.2024
បណ្តូលចិត្តរេរ៉ាវែល୨ৎ<< by ImmaRydaniaL
60 parts Ongoing
ប្រភពរឿង : ឡាវេហ្គាស សហរដ្ឋអាមេរិក
Tensura: The Abyss Demon by Wahabadebanjo
86 parts Complete
What if Rimuru was instead reborn as a primordial demon; the strongest in combat and intelligence. He reincarnated just before Star king dragon Veldanava created the omniverse; it was nothing but a void, his soul being exposed just a little to turn null made his soul undergo a change. Making him an individual with a high evolutionary potential
الادعج " قاع الظلام " by zahralsadi
43 parts Complete
الأدعج" قـاع الظلام " تنـتظـِركم لـيالـي قاسية وعيـون لاتنـّام وأيـام سوداوية فـْي أعـماق قــاع الظلام هـيا يـا رِفـاق انـتـّزعو ثـُوب النجاة لـنغوص مـعـاً فــّي حكايـة الـقتـلِ والدماء لنـُكـشف الالـغـاز تاره تاره بهـَدوء وعـقل دهـاءِ . باللهجة العراقية رواية حقيقية بقلمَـي زهراء الساعدي توضيـح لا احلل أخذ الروايـة ونشرها إطلاقًا
Hero Hunter: Izuku Yagi [opm x mha] by ManLikeETO
60 parts Ongoing
In a world where 80% of the population has quirks the other 20% doesn't. izuku yagi, the son of the number one hero was one of those 20%. Izuku Yagi's life was a nightmare, filled with bullying at school from his supposed friend bakugo and his sister izumi yagi and neglect from his family, including his father, All Might. Finding solace in the teachings of Silverfang, an S-class martial artist, Izuku transformed from a weak boy into a powerful, cold fighter. His impressive performance at the UA High School entrance exam was sabotaged by All Might, crushing his dreams. Betrayed and disillusioned, Izuku became the Hero Hunter, seeking to expose the corruption in hero society and exact revenge on those who wronged him. warning: mature language will be used *i do not own one punch man or my hero academia* *i do not own any of these characters*
The Green Flame by Pitch_Black_Knight
31 parts Ongoing
Izuku Midoriya had a good life with his pro hero mother, Inko Midoriya , his average father, Hisashi Midoriya, and his twin sister, Izumi. However, things fell apart when Hisashi was killed in the wake of a villain's rampage. At the time, the twins were three, and Inko was hit the hardest. She felt worthless for not being able to protect her husband. But when she remarried to Toshinori Yagi, things began falling into place again. The Yagi family knew happiness, except for one. When the twins got their quirk results, Izumi was blessed with a Telekinesis quirk identical to her mother's, and Izuku was seemingly born with nothing. Because of this, he faced neglect from his parents, abuse from his friends and sister, and was told by everyone to give up his dream. One day, 13-year-old Izuku couldn't take it anymore. He ran away from the family that abandoned him for being born the way he was. On that night, a miracle happened. It's amazing what you're capable of when you cut out the things that held you back. Vigilante Quirk Izuku x Harem Images used in this fanfic belong to their respective artists. My Hero Academia is owned by Kohei Horikoshi and Studio Bones.
You may also like
Slide 1 of 10
Our angel cover
From Eden | K. Dae-ho cover
The lost mafia princess cover
𝐉𝐔𝐒𝐓 𝐔𝐒 cover
𝑻𝒉𝒆 𝑺𝒆𝒄𝒓𝒆𝒕 𝒐𝒇 𝑬𝒗𝒊𝒍 cover
បណ្តូលចិត្តរេរ៉ាវែល୨ৎ<< cover
Tensura: The Abyss Demon cover
الادعج " قاع الظلام " cover
Hero Hunter: Izuku Yagi [opm x mha] cover
The Green Flame cover

Our angel

84 parts Complete

𝐀𝐫𝐢𝐚𝐧𝐧𝐚. For 11 years of her life Arianna has been pushed, beaten and forced to become a top assassin. At the age of 5, little Arianna was kidnapped after witnessing the death of her mother. 𝐀𝐫𝐢𝐚𝐧𝐧𝐚 𝐌𝐨𝐫𝐞𝐭𝐭𝐢. Missing daughter of notorious mafia don Stefano Moretti. Arianna remembers everything. She knows everything about her family (well not everything). Find out what happens when Arianna is thrown back into the arms of her father and brothers. Follow her story of lies, adventure and death as she re discovers her love for her family. Throw in a mysterious boy and overprotective brothers, guns, death and much more in her journey to finding herself.

More details