PENYEDIA WALLPAPER CUSTOM UNTUK DEKORASI MASJID
wallpaper03
  • Reads 2
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 2
  • Votes 0
  • Parts 1
  • Time <5 mins
wallpaper03
Ongoing, First published Feb 19
1 new part
dekorasiinteriormasjidjasapemasanganwallpaperpenyediadekorasimasjidpenyediawallpapercustompenyediawallpaperislamitukangberpengalamaninteriorvendordekorasiislamivendorwallpaperdekorasivendorwallpaperislamiwallpapermalangidwallpapermotifislamiwallpapernuansaislami
Bingung mencari penyedia wallpaper custom untuk dekorasi masjid Anda? 
Wallpaper Malang ID solusinya. Wallpaper Malang ID menawarkan jasa pemasangan wallpaper islami untuk membantu mengubah tampilan dekorasi masjid dan ruang ibadah Anda dengan hasil pemasangan lebih rapi dan halus, karena di kerjakan oleh tukang yang berpengalaman di bidang interior.

Wallpaper Malang ID sebagai penyedia wallpaper custom motif terpercaya di Malang yang bisa disesuaikan dengan keinginan dan selera Anda. Wallpaper Malang ID juga merupakan vendor wallpaper untuk dekorasi interior masjid dengan berbagai pilihan desain dan motif nuansa islami yang bisa disesuaikan dengan selera Anda. Wallpaper Malang ID sudah bekerja sama dengan seluruh masjid di Malang.

Detail rincian :
Bahan : vinyl
Tekstur : kulit jeruk
Minimal pemasangan : 7m²
Paket hemat : wallpaper custom free lem + jasa pemasangan Rp. 220.000/m²

Tunggu apa lagi!! Jadikan masjid dan ruang ibadah Anda lebih khusyuk dan nyaman dengan penyedia wallpapar custom untuk dekorasi masjid dari kami.

Hubungi kami di : 
WhatsApp : 087803144655 
Instagram : wallpapermalang.id
All Rights Reserved
dekorasiinteriormasjidjasapemasanganwallpaperpenyediadekorasimasjidpenyediawallpapercustompenyediawallpaperislamitukangberpengalamaninteriorvendordekorasiislamivendorwallpaperdekorasivendorwallpaperislamiwallpapermalangidwallpapermotifislamiwallpapernuansaislami
Table of contents

1 part

Sign up to add PENYEDIA WALLPAPER CUSTOM UNTUK DEKORASI MASJID to your library and receive updates
or
#51wallpapermalangid
Content Guidelines
You may also like
Masked Obsession by ILoveDrarryAndAnime
53 parts Ongoing
"You're different from what I expected," she said softly. "How so?" he asked, glancing at her. "I don't know," she replied, searching for the right words. "You just... have this way of making people feel like they matter. Even here, in this... nightmare." He was quiet for a moment before responding. "You matter, Y/n. Don't forget that." OR Y/n wakes up in the deadly Squid Game, surrounded by strangers and fighting to survive. What she doesn't know is that the mysterious Frontman is watching her every move through the cameras- and she's caught his attention.
Iron Fists | Eli Moskowitz by f4brays
86 parts Ongoing
⤷★𝔦𝔯𝔬𝔫 𝔣𝔦𝔰𝔱𝔰 "Ow! How the hell did you hit me so hard?" "Iron fists, baby." •••••• COBRA KAI , eli moskowitz seasons 1-6 spanish translation: @__Mortifaga__ ©f4brays 2021 I DO NOT OWN COBRA KAI AND/OR ITS STORYLINE! ONLY MY OCs AND THEIR STORYLINES
COWGIRLS! | Yellowstone by religioninyourlips
84 parts Ongoing
"long live cowgirls." - in which the youngest of the dutton clan comes home [yellowstone] [ryan x oc] [book one]
Naruto: Copy System by Dragon155913
192 parts Ongoing
Reborn in the Naruto world, Shin Uzumaki finds himself in the doomed Land of Whirlpools. As a member of the Uzumaki Clan! Trapped in a world filled with war, betrayal, and unimaginable power, Shin's survival seems impossible.. Until it isn't!! [Ding! Replication System Activated!] [Daily Login Reward: Common Replication Card.] [Newbie Gift: Perfect Sage Body-Adamantine Sealing Chains-Four Symbols Seal] With the power to Copy any Ability-whether it's the Kekkei Genkai or Rinnegan or Forbidden jutsu-Shin begins his journey to dominate the Ninja World. [First task: Save Kushina and prevent the destruction of the Uzumaki Clan.]
𝑴𝒊𝒏-𝒆 || Min Ho x Reader by liv__ing
44 parts Complete
(season 2 out now!) 𝒊𝒏 𝒘𝒉𝒊𝒄𝒉 two famous teens fake date... until it becomes real. (xo, kitty) __ (Y/N) Novoselsky, born to two world-renowned movie stars, is attending KISS this year. Her mother is forcing her to live in Korea: and woo the son of one of her co-stars. His name? Min Ho. The problem is, he seems rude to her, and she clearly can't stand him. But the turns are tableing when he's the one chasing after her, and he's the one who has to prove himself. ❝ you make me do stupid things ❞ ❝ are you sure you aren't doing that on your own? ❞ ⋆ ｡𖦹° ⭒˚｡⋆ #1 in xokitty #1 in minho 2/15/25 #1 in sangheonlee #1 in minhoxokitty #1 in minhoxreader #1 in to all the boys 2/15/25 #6 in fanfiction
Falling For Mikhaela Janna Jeminea Lim by duskravennn024
77 parts Complete
Mikhaela Janna Lim, daughter of a renowned business tycoon, craves a normal life away from the spotlight. She even persuades her famous friends to pretend they don't know her, all for the sake of solitude. But when her path crosses with Maraiah Queen Arceta-a social butterfly, soft talker, and academic achiever adored by many-everything changes. Will Mikhaela cling to her quiet sanctuary as an anonymous introvert, or transform herself to win Maraiah's heart?
ᴇʟʏꜱɪᴀɴ | BNHA by sxftreo
87 parts Complete
Various BNHA X Fem Reader. Where an inauspicious girl meets her doom and ultimately gets transported into the chaos of My Hero Academia.
𝓢𝓮𝓮 𝓜𝓮 by jackssfox
93 parts Ongoing
What if Aaron Warner's sunshine daughter fell for Kenji Kishimoto's grumpy son? - This fanfic takes place almost 20 years after Believe me. Aaron and Juliette had a Daughter named Emmaline Leila Warner. Kenji and Nazeera had a son named Kai Kishimoto. Started: 12, Nov, 2023 Highest Ranking: #1 booktok #1 shatterme #1 fantasyfiction #1 bookclub #2 romancefanfiction #2 warnette #2 kenjikishimoto
BURNING PILE » MIGUEL DIAZ by crownsmist
86 parts Ongoing
❝ALL MY TROUBLES ON A BURNING PILE ALL LIT UP AND I START TO SMILE.❞ MIGUEL DIAZ X FEM!OC SEASON 1 - 6 crownsmist, 2022 cover by @norasnetflix spanish & french translations are in my reading lists!
The Brink of Minds | Tim Bradford by writer_daydreamerr
44 parts Ongoing
❝I've been falling every day since I first met you.❞ stolen glances, hushed whispers, teasing breaths, lingering touches. 𝘖𝘳 𝘪𝘯 𝘸𝘩𝘪𝘤𝘩 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚 𝙢𝙚𝙚𝙩𝙨 𝙝𝙖𝙧𝙙𝙘𝙤𝙧𝙚, 𝘢𝘯𝘥 𝘮𝘢𝘨𝘯𝘦𝘵𝘴 𝘢𝘳𝘦 𝘮𝘦𝘢𝘯𝘵 𝘵𝘰 𝘢𝘵𝘵𝘳𝘢𝘤𝘵 𝘦𝘢𝘤𝘩 𝘰𝘵𝘩𝘦𝘳. ─ tim bradford x fem!oc ─ the rookie; s1 ~ s? ─ slow-burn, flirting, some spice ─ updating every other day!! ⊱ ──────── ➤ ──────── ⊰
You may also like
Slide 1 of 10
Masked Obsession cover
Iron Fists | Eli Moskowitz cover
COWGIRLS! | Yellowstone cover
Naruto: Copy System cover
𝑴𝒊𝒏-𝒆 || Min Ho x Reader cover
Falling For Mikhaela Janna Jeminea Lim cover
ᴇʟʏꜱɪᴀɴ | BNHA cover
𝓢𝓮𝓮 𝓜𝓮 cover
BURNING PILE » MIGUEL DIAZ cover
The Brink of Minds | Tim Bradford cover

Masked Obsession

53 parts Ongoing

"You're different from what I expected," she said softly. "How so?" he asked, glancing at her. "I don't know," she replied, searching for the right words. "You just... have this way of making people feel like they matter. Even here, in this... nightmare." He was quiet for a moment before responding. "You matter, Y/n. Don't forget that." OR Y/n wakes up in the deadly Squid Game, surrounded by strangers and fighting to survive. What she doesn't know is that the mysterious Frontman is watching her every move through the cameras- and she's caught his attention.

More details