JASA PASANG WALLPAPER VINYL UNTUK RUANG TAMU
jasapemasangan
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
jasapemasangan
Ongoing, First published 4 days ago
1 new part
jasapasangwallpaperpaketpasangwallpapervinylpasangwallpaperdisingosaripenyediawallpapervinylwallpaoervinylruangtamuwallpapervinylmodernwallpapervinylmotifwallpapervinylrollwallpapervinyltimbul
JASA PASANG WALLPAPER VINYL UNTUK RUANG TAMU

Anda bingung mencari penyedia wallpaper vinyl untuk ruang tamu? Wallpaper Malang Id solusinya. Kami menyediakan wallpaper vinyl dengan berbagai desain motif dan warna yang berkualitas, cocok untuk dijadikan dekorasi dinding ruangan Anda. Wallpaper Malang Id juga menyediakan paket pasang wallpaper vinyl roll dengan harga terjangkau, yang akan membantu memberikan kesan elegan pada ruangan Anda. 

Wallpaper Malang Id menyediakan wallpaper vinyl timbul dengan pilihan bahan yang berkualitas yang akan merubah suasana ruangan Anda menjadi lebih modern dan elegan.  Serta menyediakan jasa pasang wallpaper di singosari, terutama untuk anda yang sedang mencari jasa pasang wallpaper di singosari, Wallpaper Malang ID adalah pilihan yang tepat.

Detail rincian wallpaper vinyl:
Bahan: vinyl
Minimal pemasangan: 5 Roll
Paket hemat: wallpaper vinyl free lem + jasa pasang: Rp 190.000 - 290.000/Roll

Tunggu apalagi ubah tampilan ruangan Anda menjadi lebih modern dengan jasa pasang wallpaper vinyl untuk ruang tamu. Hubungi kami untuk konsultasi lebih lanjut:

Whatsapp : 087803144655
Instagram : wallpapermalangid

#wallpapermalangid
#wallpapervinyltimbul
#wallpapervinylroll
#penyediawallpapervinyl
#paketpasangwallpapervinyl
#jasapasangwallpaper
#wallpaoervinylruangtamu
#wallpapervinylmodern
#wallpapervinylmotif
#jasapasangwallpaper
#pasangwallpaperdisingosari
All Rights Reserved
jasapasangwallpaperpaketpasangwallpapervinylpasangwallpaperdisingosaripenyediawallpapervinylwallpaoervinylruangtamuwallpapervinylmodernwallpapervinylmotifwallpapervinylrollwallpapervinyltimbul
Table of contents

1 part

Sign up to add JASA PASANG WALLPAPER VINYL UNTUK RUANG TAMU to your library and receive updates
or
#4jasapasangwallpaper
Content Guidelines
You may also like
Kinnporsche Incorrect Quotes Part 2 by Saawturnn
99 parts Ongoing
continuation of kp incorrect quotes because my lovely readers approved (Might have crosseovr with other Bl's)
My Fake Boyfriend by ToTheExtreme95
134 parts Complete
He was so close, his breath hit my lips. His eyes darted from my eyes to my lips. I stared intently, awaiting his next move. His lips fell near my ear. "Shut up and kiss me" He whispered roughly. A chill shot up my spine. I pulled back, staring at his eyes and leaned in.. ********** What happens when Alexis Dawson- "residential loser" of Redwood High, agrees to help Redwood High's player, Aaron Walker. How can she stop herself from falling for him? But it isn't all love and romance, Alexis has her own secret. Join them on the journey filled with jealousy, betrayal, trust, friendship and love. A little favour just got a whole lot more complicated.
( مالي وطن في نجد ألا وطنها) by jess_25s
70 parts Ongoing
( مالي وطن في نجد ألا وطنها)
3 Stepbrothers by Animallover55
95 parts Complete
PUBLISHED ON AMAZON --GET PHYSICAL COPY OR EBOOK ALSO AVAILABLE ON BARNES & NOBLE www.sofiaqholand.com Merchandise also available Tori lived with her dad and little sister. She never expected to have a stepmother, much less a stepbrother. But whats worse is not only one stepbrother, not two either. No three stepbrothers. But it gets worse, the three boys just happen to be the three triplet sport stars of the school. The same three boys that have gone out with nearly all those girls that wear short short skirts. The same three boys that are known as 'The Parris Sport Brothers.' What happens when the four are mixed together and agree not to tell anyone that there brothers? What happens when the four are forced to get to know each other? What happens when they have to learn to live with each other? After all its just one year right. All of them heading to college next year. Just one year right? One hectic year of broken hearts, sibling feuds and bonding, of out of nowhere events. Read the book to find out what happens to Tori. Started 2013 Completed 2017 Published 2020
My Billionaire Master: How I Ended Up Marrying A Disabled CEO by Sandhya_sss
45 parts Ongoing
"Will you marry my Disabled son?" "Oh! Fuck No! I am a straight guy, I cant marry another man" "I will pay you 10 million dollars for it💰💰💲" "Do you want me to wear a Lehanga or saree at my wedding?" It was a simple choice for Ishan, a financially struggling guy in his 20s burdened with family responsibilities. He would do anything to be rich.. Even sacrifice his sexuality and masculinity in the process. Check my new story where our protagonist takes some wild ride to earn money.
Ang mutya ng section e by maryloise202
49 parts Ongoing
fan made only inspired by ate lara<3
Babymonster Incorrect Quotes by ImAddractive
185 parts Ongoing
TELL A FRIEND, TELL A FRIEND, TELL A FRIEND 🧡 All credits to the original owners
Book Transmigration: I Wanted to Keep a Low Profile, but Everyone Noticed Me! by Khushi_KK_20
200 parts Complete
(Book 1) Synopsis Audrey woke up and found that she had transmigrated into a book. As a mediocre actress, Audrey was satisfied with her income. Even though her parents favored boys over girls, at least she could support herself. Just when she had finally saved up some money and hadn't had a chance to enjoy it, she ended up in a different world?! She didn't know if it was God's mercy or compensation, but Audrey's role in the book was a wealthy heiress. In the book, her birth mother arranged for Audrey to be married into a wealthy family, and she had to compete with her other siblings for the family inheritance. The tragic outcome was predictable. Confused by the original character's actions, Audrey decided to lay low and become a wealthy but useless person. One day, Audrey's family members noticed that she had changed. Strangely enough, they could read her thoughts on her face. Even her second brother, who had always treated her like air, could see her sarcastic comments about him. [What's with that outfit today? Does he really think he looks good?] And when he was about to give up his directing career and return to the company, he could see the words on Audrey's face. [Why fight for power? Isn't it better to do what you love and still make money? You're so foolish.] Second brother: '...That makes sense.' The eldest sister, who had always ignored the subtitles on Audrey's face, finally noticed them one day. [Is she being foolish? Is it worth marrying for power? Doesn't she have enough money of her own?] After looking at her own wealth, the eldest sister quietly rejected the arranged marriage. Later on, Audrey noticed that her pocket money was increasing. As she gazed at the jewelry her second brother and eldest sister gave her, she fell into deep thought. THIS STORY IS NOT MINE!!!!! FOR OFFLINE PURPOSES ALL CREDITS TO THE AUTHOR AND TRANSLATOR. ... Book 1 (Completed) ✅ Book 2 (Ongoing)
"I HATE YOU!!!" | Dandy's World (Finn x Shrimpo) by finnsbodypillow
16 parts Ongoing
im currently feeding us ragebait shippers . . . we need more of this content argauhfeheggage this is my first wattpad story ever so if its bad please bear with me thank you guys so muchhhh for 10 duotrigintillion reads omfg I never though it would get this popular
Dandy's World Gc🌼🌈 by Ur_L0calSolarballfan
57 parts Ongoing
This is the Dandy's World Gc!! I decided to make one cuz yes I may not upload stories often but I'll try my best to upload! Am I the first one to make this? Cover art by me!! :D
You may also like
Slide 1 of 10
Kinnporsche Incorrect Quotes Part 2 cover
My Fake Boyfriend cover
( مالي وطن في نجد ألا وطنها) cover
3 Stepbrothers cover
My Billionaire Master: How I Ended Up Marrying A Disabled CEO cover
Ang mutya ng section e cover
Babymonster Incorrect Quotes cover
Book Transmigration: I Wanted to Keep a Low Profile, but Everyone Noticed Me! cover
"I HATE YOU!!!" | Dandy's World (Finn x Shrimpo) cover
Dandy's World Gc🌼🌈 cover

Kinnporsche Incorrect Quotes Part 2

99 parts Ongoing

continuation of kp incorrect quotes because my lovely readers approved (Might have crosseovr with other Bl's)

More details