SUPPLIER WALLPAPER VINYL UNTUK PERUMAHAN
wallpaper03
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
wallpaper03
Ongoing, First published 2 days ago
1 new part
distributorwallpapervinyljasapemasanganwallpaperpenyediawallpaperterlengkappenyediawallpapervinylsupplierwallpapervinylvendorwallpapervinylvinylrollberkualitasvinylrollmotifvinylrolltimbulwallpapermalangidwallpapervinylperumahan
Bingung mencari supplier wallpaper vinyl untuk perumahan Anda? Wallpaper Malang ID solusinya. Wallpaper Malang ID merupakan vendor wallpaper vinyl roll timbul berkualitas dengan motif unik dan kekinian. selain itu kami juga distributor wallpaper vinyl roll motif yang bisa menyesuaikan dengan keinginan dekorasi Anda. Wallpaper Malang ID sudah dipercayai menjadi vendor wallpaper vinyl untuk dekorasi interior perumahan di Malang dan sekitarnya.

Sebagai penyedia wallpaper vinyl terlengkap, kami menyediakan berbagai pilihan motif yang menarik untuk perumahan. Untuk pemasangan Kami  menyediakan jasa pemasangan wallpaper dengan tawaran harga yang terjangkau.

Detail Rincian Wallpaper Vinyl :
Bahan : Vinyl
Minimal Pemasangan : 5 Roll
Paket hemat wallpaper vinyl free lem + jasa pasang : Rp. 190.000 - 290.000/Roll

Tunggu apalagi? Segera hubungi kami supplier wallpaper vinyl untuk perumahan, tentunya Wallpaper Malang ID. Untuk konsulatasi lebih lanjut:

WhatsApp : 087803144655 
Instagram : wallpapermalang.id
All Rights Reserved
distributorwallpapervinyljasapemasanganwallpaperpenyediawallpaperterlengkappenyediawallpapervinylsupplierwallpapervinylvendorwallpapervinylvinylrollberkualitasvinylrollmotifvinylrolltimbulwallpapermalangidwallpapervinylperumahan
Table of contents

1 part

Sign up to add SUPPLIER WALLPAPER VINYL UNTUK PERUMAHAN to your library and receive updates
or
#53wallpapermalangid
Content Guidelines
You may also like
The Witcher - Uchiha Madara! by DazeRaccoon
152 parts Ongoing
Waking up in the body of a 6-year-old boy a few years before Cintra is destroyed, Madara receives a system that gives him the ability to gain the powers of Uchiha Madara. [The peak of Uchiha Madara's system is before he becomes the ten-tails jinchuuriki.]
My Little Vampire (Male Wednesday x Reader) by SriyaRout
39 parts Ongoing
MALE WEDNESDAY X READER "I love you...Wednesday Addams" The girl cried while hugging him as tight as she could. "I love you too....Amore mio. Please always keep my cold, black heart with you. I don't like my heart being mine anymore." Wednesday said before kissing her on forehead. ______________🌸☠️_______________ They say opposite attracts. "You're bars and I'm books. You're jokes and I'm shy smiles. You're melody and I'm lyrics. You're cautious and I'm impulsive. You're bubbly and I'm calm. You're sweet and I'm bitter. So, why is every cell in my body wishing you to be mine?" - Wednesday Addams --------------------------☠️🌸------------------------
Metropolis Heroes! - A Sonic Movie and DC Super Hero Girls Crossover by Sonicspeedstar
35 parts Ongoing
(After the events of "Knuckles" and before "Sonic the Hedgehog 3") What do you get when you mix three mobians and six suddenly magically and pretty automatically teenagers with a hint of humor from Rise of the Teenage Mutant Ninja Turtles? You get a mixture of chaos! After moving from the small town of Green Hills, Montana to the big city of Metropolis, Sonic, and his friends/brothers, Tails and Knuckles, are struggling with their new life in the big city, starting at a new school, which is as boring as it sounds, but after a food fight occurs they meet the Super Hero Girls! Who Team Sonic end up teaming up with for some amazing and awesome adventures while taking down new and powerful threats! It's a new city with the same old Sonic Heroes! I do NOT own these characters! The Sonic Movies are owned by Paramount Pictures, Original Film, & SEGA DC Super Hero Girls is owned by Cartoon Network, DC, Warner Bros. Animation and Lauren Faust Disclaimer!: The story for people 13 & up, as some episodes contain mild foul language, innuendo, inappropriate jokes and remarks, sneaky retorts and suggestions about sex, and some PG-13 moments (Making-out, swearing, and a bit of blood). You have been warned.
soulmate of tom riddle by elsbelles26
129 parts Complete
Hope Potter, a female Harry Potter finds out that she the soulmate to Tom Riddle in her 3rd year at Hogwarts.
💮Mafa's Love Game(or)နှောင်ကြိုးတစ်ခု💮 by HATE_36
73 parts Ongoing
အချစ်ဆိုတာ လူသတ်ရတာလောက် ရင်ခုန်စရာမကောင်ဘူး ကူ ကိုယ်အတွက်အချစ်ဆိုတာကစားစရာထပ်မပိုဘူး State Date_11....4..2023 Complete Date_
The Undetermined || pjo by TeenWriter77
74 parts Ongoing
Liz is an unclaimed kid with no family and no idea of who she is. Her only home is Camp Half-Blood When Camp is at risk of being in the middle of a war because of the Gods that don't care about her, she will not sit back and watch as it happens. WARNING! ‼️ Violence-Curses-Deaths-mentions of suic!des-suic!des attempts
Ash And Horizons by Rekuta1
55 parts Ongoing
Ash Ketchum has finished the world championship, but that also means he's closer to be a pokemon master. He already continue his adventure after his depart with Goh and Chloe, but he also already finished his other adventure. Ash don't know what to do after beating the championship, but it looks like Delia able to step ahead and give Ash something to do: a School life. The story will be having Ash in Pokemon Horizon, but i'll try to make Ash character better in this story Also Ash and Liko are 10 years old cuz some people in discord sat i should add it in description.
Quick Wear: I am your nanny (1) by Axellianian
147 parts Ongoing
快穿之我是你们的奶妈_小新子 【完结】 内容简介： 　Quick travel + no CP + cool story + no Mary Sue Li Dazui is a nanny. She will travel to various small worlds to be the nanny of various characters. 　　There are tragic female protagonists, vicious female supporting roles , middle school presidents , and sunny, righteous and excellent male supporting roles. 　　The tragic heroine who had her kidneys cut off, don't be afraid, the nanny will cut off that bastard's kidneys to compensate you. 　　Don't panic, vicious female supporting character, the nanny will teach you a lesson. 　　No matter how lonely the end of the world gets, she will always be by their side. PS. THIS IS NOT MY NOVEL IT WAS JUST A TRANSLATION OF AN ACTUAL NOVEL FROM DIFFERENT WEBSITES
Sr, I am a Woman by WitchandAngel
30 parts Complete
Alex è nata con un carattere maschile, cresciuta per essere Conte visto l'assenza di altri figli e in generale ha praticato arti più da uomo che da donna. Era normale visto che il padre non sapeva come crescere una ragazza no? Le cose andavano anche bene per lei, aveva amiche, aveva corteggiatori... -Devi mettere muscoli o non troverai moglie -Sr, non ho interesse in trovare moglie -Ah! Vedrai che te la trovo moglie E un love interest della novel in cui era che non capiva che era una femmina...
Wings of the Grand Line | One Piece x Male Reader by LaidbackGiraffe
44 parts Ongoing
"Could these people bring justice to my home?" After barely escaping his homeland, (Y/N) wandered the Grand Line, searching for those who could help him right the wrongs he had witnessed. Every step of his journey exposed him to more corruption, injustice, and evil, but it also showed him how wonderful the world could be. One fateful day, he crossed paths with a peculiar crew of pirates who called themselves the "Straw Hats." They were unlike any pirates he had ever encountered. __________________________________________________________________________________ The main love interest is Hiyori. I don't own the characters or the story of One Piece. All rights belong to the owners.
You may also like
Slide 1 of 10
The Witcher - Uchiha Madara! cover
My Little Vampire (Male Wednesday x Reader) cover
Metropolis Heroes! - A Sonic Movie and DC Super Hero Girls Crossover cover
soulmate of tom riddle cover
💮Mafa's Love Game(or)နှောင်ကြိုးတစ်ခု💮 cover
The Undetermined || pjo cover
Ash And Horizons cover
Quick Wear: I am your nanny (1) cover
Sr, I am a Woman cover
Wings of the Grand Line | One Piece x Male Reader cover

The Witcher - Uchiha Madara!

152 parts Ongoing

Waking up in the body of a 6-year-old boy a few years before Cintra is destroyed, Madara receives a system that gives him the ability to gain the powers of Uchiha Madara. [The peak of Uchiha Madara's system is before he becomes the ten-tails jinchuuriki.]

More details