JASA PASANG WALLPAPER VINYL UNTUK HOTEL
wallpaper03
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 1
  • Votes 0
  • Parts 1
  • Time <5 mins
wallpaper03
Ongoing, First published 1 day ago
1 new part
distributorpenyediajasapasangpaketpasangpasangwilayahmalangpenyediajasavinylrollmotifwallpaperhotelwallpaperkotamalangwallpapermalangidwallpapervinyl
JASA PASANG WALLPAPER VINYL UNTUK HOTEL

Bingung mencari jasa pasang wallpaper vinyl untuk hotel di Malang? Wallpaper Malang ID solusinya. Wallpaper Malang ID merupakan penyedia jasa pasang wallpaper vinyl di Malang dengan beragam pilihan desain menarik yang bisa mengubah tampilan hotel Anda menjadi lebih menarik dan elegan. Selain itu kami juga sebagai distributor penyedia wallpaper vinyl yang telah dipercayai untuk proyek dekorasi hotel bintang lima di Malang.

Wallpaper Malang ID menjual wallpaper vinyl roll motif yang bisa disesuaikan dengan keinginan dekorasi interior hotel Anda. Untuk pemasangan wallpaper vinyl, kami menyediakan jasa pasang wallpaper wilayah Kota Malang dengan harga yang lebih terjangkau.

Detail Rincian Wallpaper Vinyl :
Bahan : Vinyl
Minimal Pemasangan : 5 Roll
Paket hemat wallpaper vinyl free lem + jasa pasang : Rp. 190.000 - 290.000/Roll

Tunggu apalagi? jadikan hotel Anda menjadi lebih elegan dengan jasa pasang wallpaper vinyl untuk hotel, hanya di wallpaper Malang id. Hubungi kami untuk konsulatasi lebih lanjut:

WhatsApp : 087803144655 
Instagram : wallpapermalang.id
All Rights Reserved
distributorpenyediajasapasangpaketpasangpasangwilayahmalangpenyediajasavinylrollmotifwallpaperhotelwallpaperkotamalangwallpapermalangidwallpapervinyl
Table of contents

1 part

Sign up to add JASA PASANG WALLPAPER VINYL UNTUK HOTEL to your library and receive updates
or
Content Guidelines
You may also like
𝐉𝐔𝐒𝐓 𝐔𝐒 by -GEEKER
26 parts Ongoing
❝𝐈𝐓𝐒 𝐉𝐔𝐒𝐓 𝐔𝐒 𝐀𝐆𝐀𝐈𝐍𝐒𝐓 𝐓𝐇𝐄 𝐖𝐎𝐑𝐋𝐃.❞
BINI ONESHOTS by Jg-Onyourway
43 parts Ongoing
Along with the feather's A God who created an Inters*x People
Hero Hunter: Izuku Yagi [opm x mha] by ManLikeETO
60 parts Ongoing
In a world where 80% of the population has quirks the other 20% doesn't. izuku yagi, the son of the number one hero was one of those 20%. Izuku Yagi's life was a nightmare, filled with bullying at school from his supposed friend bakugo and his sister izumi yagi and neglect from his family, including his father, All Might. Finding solace in the teachings of Silverfang, an S-class martial artist, Izuku transformed from a weak boy into a powerful, cold fighter. His impressive performance at the UA High School entrance exam was sabotaged by All Might, crushing his dreams. Betrayed and disillusioned, Izuku became the Hero Hunter, seeking to expose the corruption in hero society and exact revenge on those who wronged him. warning: mature language will be used *i do not own one punch man or my hero academia* *i do not own any of these characters*
غوث الانشطار by lletxi
25 parts Ongoing
مـا سَتقرأونهُ في "غَوث الانشطار" إنفـِصالات لَيسَ لها عَدد وأشقـاء في سجنٌ مِن مَدد مُحاولات لإبـادة أشخاصٌ تَرتدد لَـكن نُحاول أن نحَل لِغز الأحداث وَنرى جَبروت الأبطـالَ بالتَشدد .. مَريم العَّليْ غوث الانشطار
Tensura: The Abyss Demon by Wahabadebanjo
86 parts Complete
What if Rimuru was instead reborn as a primordial demon; the strongest in combat and intelligence. He reincarnated just before Star king dragon Veldanava created the omniverse; it was nothing but a void, his soul being exposed just a little to turn null made his soul undergo a change. Making him an individual with a high evolutionary potential
The Lost De'Luca by SymplyNath
87 parts Complete
Amazing cover by Anel_Graphics Gabriella De'Luca is a cold fifteen year old girl, who has had to go through extreme hardships everyday of her life. Constantly being abused by her mother's boyfriend. He made her life a living hell yet she still loved her mother who made everything seem a little bit better. Her mother was her light in the end of the tunnel What happens when that light is suddenly snatched away from her and she is thrown into the care of nine brothers who she knew nothing about Will Gabriella open up to them or will she still keep her walls up?. Will she learn to trust them or keep her scars to herself? Please read to find out more (•‿•) The chapters are a bit short in the beginning but I promise they'll get longer as you read on
Politician's Love by _authorButterfly_
42 parts Ongoing
Rudransh Singh Yaduvanshi Just a powerful politician in India but those who are involved in underworld knows his real wrath. Known as Sinister in underworld. Has a wild net worth of 900$ billion dollar. The current Mafia king and the world's richest man, behaves like an iceberg to everyone except his wife and has 2 siblings. In love with his wife since he met her, calls her Anvi. Ishanvi Rudransh Singh Yaduvanshi Wife of Rudransh Yaduvanshi. For the world she is perfect and ideal daughter-in-law and a world renowned neurologist by profession. But she too is the current Mafia queen but nobody knows her as her name in underworld is Velvet. Has a bubbly nature for her loved ones only. Both of them loves eachother but doesn't have courage to confess. He was in dark, she became his ray of light. He was merciless,cold for the world,but soft and possesive for his Anvi. He who loves to make others cry, but ached when she cried. He was broken, but she healed him. She was there when he was building his own empire, now he will do everything to make her stay when he has everything. Mafialove Eldest son×eldest daughter Grumpy×sunshine He fell first and harder Cold to everyone but her If you're searching for a book with no grammatical mistake, this book is not for you.
The Green Flame by Pitch_Black_Knight
31 parts Ongoing
Izuku Midoriya had a good life with his pro hero mother, Inko Midoriya , his average father, Hisashi Midoriya, and his twin sister, Izumi. However, things fell apart when Hisashi was killed in the wake of a villain's rampage. At the time, the twins were three, and Inko was hit the hardest. She felt worthless for not being able to protect her husband. But when she remarried to Toshinori Yagi, things began falling into place again. The Yagi family knew happiness, except for one. When the twins got their quirk results, Izumi was blessed with a Telekinesis quirk identical to her mother's, and Izuku was seemingly born with nothing. Because of this, he faced neglect from his parents, abuse from his friends and sister, and was told by everyone to give up his dream. One day, 13-year-old Izuku couldn't take it anymore. He ran away from the family that abandoned him for being born the way he was. On that night, a miracle happened. It's amazing what you're capable of when you cut out the things that held you back. Vigilante Quirk Izuku x Harem Images used in this fanfic belong to their respective artists. My Hero Academia is owned by Kohei Horikoshi and Studio Bones.
Harry Potter And The Shadow by Radcliffe_yanessa
13 parts Ongoing
After years, Tom Riddle decides to take what is his, even his little Horcrux.
جمال العذارى كلهم بدون جدال by rrem887
28 parts Ongoing
جميله
You may also like
Slide 1 of 10
𝐉𝐔𝐒𝐓 𝐔𝐒 cover
BINI ONESHOTS cover
Hero Hunter: Izuku Yagi [opm x mha] cover
غوث الانشطار cover
Tensura: The Abyss Demon cover
The Lost De'Luca cover
Politician's Love cover
The Green Flame cover
Harry Potter And The Shadow cover
جمال العذارى كلهم بدون جدال cover

𝐉𝐔𝐒𝐓 𝐔𝐒

26 parts Ongoing

❝𝐈𝐓𝐒 𝐉𝐔𝐒𝐓 𝐔𝐒 𝐀𝐆𝐀𝐈𝐍𝐒𝐓 𝐓𝐇𝐄 𝐖𝐎𝐑𝐋𝐃.❞

More details