Story cover for Avengard Chronicles by Tomato_Tenshi123
Avengard Chronicles
Tomato_Tenshi123
  • WpView
    Odsłon 93
  • WpVote
    Głosy 0
  • WpPart
    Części 16
  • WpHistory
    Czas 2h 23m
  • WpView
    Odsłon 93
  • WpVote
    Głosy 0
  • WpPart
    Części 16
  • WpHistory
    Czas 2h 23m
Tomato_Tenshi123
W trakcie, Pierwotnie opublikowano mar 02, 2025
actionadventuredarkfantasyfastpacedmagicmedieval
A young man named Rinero is suddenly ripped out of his comfortable village life by the mysterious mage Zetarnu and sets out on a dangerous quest. Join him as he explores the continent of Avengard and its many kingdoms while also avoiding its many perils. For on the grim continent of Avengard an eternal war rages.
Wszelkie Prawa Zastrzeżone
actionadventuredarkfantasyfastpacedmagicmedieval
Spis treści

16 części

Zarejestruj się, aby dodać Avengard Chronicles do swojej biblioteki i otrzymywać aktualizacje
lub
#771fastpaced
Wytyczne Treści
To może też polubisz
The Rising of the new forest king autorstwa Sneaky1985
10 części Zakończone
A young man finds out he is a mage, in a century that captures mages. The mages they capture is used to fight for entertainment. BUT this young man has an ability almost unheard of.
"Phoenix Ascendant: Jean Grey in the 40K Universe" Marvel X Warhammer 40K autorstwa Chris9417
31 części Zakończone
When Jean Grey, host of the Phoenix Force, is mysteriously transported from her world to the grim darkness of the Warhammer 40K universe, she finds herself in a galaxy ruled by war, Chaos, and psychic horrors beyond imagination. Struggling to control the immense power within her, Jean must navigate the political and deadly complexities of the Imperium while resisting the seductive whispers of Chaos. By her side is Gideon Rahl, a steadfast warrior and strategist whose unwavering presence becomes her anchor in a universe designed to destroy hope. Together, they battle rogue psykers, Slaaneshi cults, and Tzeentchian manipulations, forging trust and love amidst war. Amidst the blood and fire, Jean discovers a new purpose: founding her own team-the X-Men-mentoring gifted individuals, and creating a legacy of hope in a galaxy that has forgotten it. Phoenix Ascendant is an epic Isekai crossover of Marvel Comics and Warhammer 40K, blending psychic powers, cosmic battles, forbidden romance, and the birth of a new generation of heroes in a universe of darkness.
The Kingdom of Smoke and Secrets autorstwa ShadesOfScarlett
49 części Zakończone
Eight Houses. One Kingdom. A fragile peace that hides cracks deep enough to shatter everything. Prince Aurelien of House Chrysos is bound by duty, expectation, and a crown he's not sure he wants. Sent on a royal tour across the elemental Houses, he begins to see the Kingdom not through the eyes of an heir, but as a man-one who questions the balance of power and the cracks beneath the surface. Tala of House Zoetic is a gifted Healer, tied to the land and its creatures through an unbreakable bond. But her choice to walk a different path than her family has cost her dearly. When her world collides with Auro's, their fragile alliance begins to spark with something more-something neither of them is ready to face. Jessamy of House Verdant is running-from her past, from her failures, and from a choice she cannot take back. Following a mysterious pull deep into forbidden territory, she discovers a truth long buried, one that could set the Kingdom ablaze or save it from ruin. But rebellion stirs in the shadows, and secrets older than the Kingdom itself are beginning to resurface. In a land where fire dances, water sings, and shadows keep their own counsel, every choice carries a price. Some paths are chosen. Some are forged in fire. And some lead to the edge of everything.
Stray To Reverence autorstwa Jeanie_May
10 części W trakcie Dla dorosłych
Jean Forgeheart, a young gnome smith, only wants to forge a living to help her sister recover from a mysterious curse. But when her friend Abbigail Lightrider pulls her into a rising insurgency against their nation's occupiers, Jean's world is shattered. Once focused only on her sister's survival, she now stands among rebels fighting for freedom. Can she find meaning in their cause? And will she uncover the truth behind her sister's curse before it's too late?
Cloaked | Book 1 autorstwa NK2101
21 części Zakończone
"We know this fight won't be easy. In fact, it'll be one of the hardest things you'll encounter in your life. You have to be passionate about this rebellion. People will die. But this fight isn't only to save us. It's to save the generations after us and to ensure that no one ever has to live through the President's tyranny ever again. It's to give everyone a better future. Think about it." Vivian King can't remember a time when the world wasn't controlled by a tyranny. She only knows oppression and misery. But never had she seen it first hand until her parents were murdered by the Presidents henchmen. Vivian chooses to join a fight that will ultimately bring freedom or destruction to her city. The question is, does she have what it takes?
The Guardians (The Highest Order, Book One) autorstwa Hidden-Alice
25 części Zakończone
Faith's life has been anything but easy. From the divorce of her parents to moving to a completely different state, she has to learn to accommodate the changes that have come to her life in such a short amount of time. The thing is, this town is different, and she's beginning to notice small things that set certain individuals apart from others. Being thrusted into a world of change, a world, she needs to save, how will Faith cope when she realises that everything she thought she knew, turns out to be wrong? This town is going to make or break her. The only question is, which one will it be?
Golden Dream autorstwa NalidO21
5 części W trakcie
A world where magic is stronger than wood finds itself in the stage of a terrifying prophecy that was told a long time ago. The kingdoms find themselves in a very hard situation as a new Triarch rises to power.
Luna autorstwa sweetarcher23
24 części W trakcie
Luna's magic has a pulse of its own. A second heartbeat beneath her skin-restless, watchful, and growing stronger. Once a nameless orphan rescued from the ruins of the Witch Domain, Luna is raised as the heir to Moonhaven, a kingdom built on moonlight and fragile peace. Chosen to rule, she becomes both shield and symbol for a world still scarred by war. Her magic is powerful, immediate, and indispensable-but it is no longer entirely hers. As ley lines weaken and ancient forces stir, the darkness entwined with Luna's power begins to surface. It hums in her veins, bleeds into her spells, and tightens its grip with every life she saves. Each battle fought in defense of her people brings the shadow closer to the surface. When the darkness lives beneath your skin, how long can you command the light before it answers something else?
Hell's Gate: Rise of Hell's Gate autorstwa hjosiah811
część 1 Zakończone
Nicholas finds himself in a strange predicament, stranger than most, that'll take him on the most perilous journey known to man. Follow him through dimensions, sadness and battles in this fantastical fantasy adventure!
The Stranger in the Looking Glass autorstwa SarahSokol5
56 części Zakończone
Cary has never considered herself anything special. She's just another desert-dweller trying to survive the harsh conditions of Red Valley. But when she's struck by a lightning storm believed to be sent by a Goddess, she finds herself forced to leave her home and embark on a perilous journey to the Golden City--a place spoken about only in legend. On the path, she's captured by a fanatical religious group that demands she unlock a magical power only she can truly understand. Her only hope of freedom lies in an alliance with Ran, a wealthy boy who seems like Cary's opposite in every conceivable way. Together, they must navigate a world of shifting alliances, unknown magic, and the looming question of who they truly are in the chaos of survival. As Cary's journey unfolds, she discovers that finding what really matters may be the greatest challenge of all.
To może też polubisz
Slide 1 of 10
The Rising of the new forest king cover
"Phoenix Ascendant: Jean Grey in the 40K Universe" Marvel X Warhammer 40K cover
The Kingdom of Smoke and Secrets cover
Stray To Reverence cover
Cloaked | Book 1 cover
The Guardians (The Highest Order, Book One) cover
Golden Dream cover
Luna cover
Hell's Gate: Rise of Hell's Gate cover
The Stranger in the Looking Glass cover

The Rising of the new forest king

10 części Zakończone

A young man finds out he is a mage, in a century that captures mages. The mages they capture is used to fight for entertainment. BUT this young man has an ability almost unheard of.

Więcej szczegółów