Silent Whispers
sandicee
  • Reads 15
  • Votes 0
  • Parts 2
  • Time 49m
  • Reads 15
  • Votes 0
  • Parts 2
  • Time 49m
sandicee
Ongoing, First published 5 days ago
2 new parts
actionaespaatmosphereconspiracydarkdetectiveeeriefanfictionfictionjiminjiminjeongkarinaminjeongmysteryparanormalpsychologicalromancesupernaturalsuspensethrillerurbanurbanfantasywinrinawinter
Silent Whispers follows the journey of two extraordinary women-Karina, a cold and calculating investigator haunted by her past, and Winter, a charismatic and fearless agent who has a knack for making people trust him. When they are hired to investigate the mysterious disappearance of a journalist in a city shrouded in darkness, they are drawn into a web of conspiracies, strange disappearances, and eerie whispers that seem to follow them wherever they go.

As the investigation deepens, the two women uncover a chilling truth-the whispers are not just figments of the mind, but a force calling them toward a hidden power, one that could change the world forever. But with every step closer to the truth, the stakes grow higher, and they must confront not only dangerous enemies but their own fears and insecurities.

In a city where nothing is what it seems, Karina and Winter must rely on each other to unravel the mystery before the whispers lead them into the heart of darkness.
All Rights Reserved
actionaespaatmosphereconspiracydarkdetectiveeeriefanfictionfictionjiminjiminjeongkarinaminjeongmysteryparanormalpsychologicalromancesupernaturalsuspensethrillerurbanurbanfantasywinrinawinter
Table of contents

2 parts

Sign up to add Silent Whispers to your library and receive updates
or
#5atmosphere
Content Guidelines
You may also like
MISTRESS OF FLAME by CeCeLib
82 parts Complete
[ BOOK 1 OF AZITERA: YTHER'S QUEEN ] Consumed by avarice, the four human kingdoms-the Infernal Empire, the Kingdom of Caelum, the Kingdom of Treterra, and the Nayale Archipelago-betrayed their covenant with Yther of Azitera, the race blessed by deities, who protected humans for untold centuries. They slaughtered and defiled the beings that once protected them from storm, famine, poverty, and pestilence without mercy. Betrayed by the humans they protected, the Ytherians were enslaved. Their four queens were caged, chained, and imprisoned to serve as nutrients to the human kingdoms. The once prominent Ytherians were reduced to nothing but servants. As the four kingdoms of the human race prospered for many years since their betrayal, one news staggered them, causing them to tremble in fear and rally their armies to protect and defend their domain: Sollel-the Mistress of Flame, one of Yther's queens-had escaped her prison. Her flames will raze hell, ready to burn the souls of her betrayers. COMPLETED CECELIB | C.C. COVER: ASTRID JAYDEE
The Exiled Alpha | ✓ by Silverless
37 parts Complete
"It's like he's a different breed of werewolf. Something... beyond us." • • • Adrienne Gage has spent her entire life being shunned and punished for her mouthy attitude, and being loyal to a pack which doesn't deserve her loyalty. It's been a year since her last punishment, and she's been walking on eggshells to keep herself in the clear. But now, that's all being threatened to be taken away if she doesn't abide by what the Alpha's son wants; and that's her as his Luna. At the same time, terrified whispers are circulating around. Mentions of a tyrant Alpha looking for a new pack to conquer. Adrienne thinks nothing of everyone else's paranoia. That is until she finds herself half conscious and being dragged away deeper into the woods with canines around her neck. Highest Ranking #1 in Paranormal Highest Ranking #1 in Werewolf Highest Ranking #1 in Romance Cover made by @Silverless COMPLETED
The Boyfriend App by phenomenalpen
3 parts Complete
*Wattys 2018 Winner / Hidden Gems* CREATE YOUR OWN MR. RIGHT Weeks before Valentine's, seventeen-year-old Kate Lapuz goes through her first ever breakup, but soon she stumbles upon a mysterious new app called My Dream Boyfriend, an AI chatbot that has the ability to understand human feelings. Casually, she participates in the app's trial run but finds herself immersed in the empathic conversations with her customizable virtual boyfriend, Ecto. In a society both connected and alienated by technology, Kate suspects an actual secret admirer is behind Ecto. Could it be the work of the techie student council president Dion or has Kate really found her soulmate in bits of computer code? She decides to get to the bottom of the cutting-edge app. Her search for Ecto's real identity leads Kate to prom, where absolute knowledge comes with a very steep price.
The Beast by palepinkferriswheel
52 parts Complete
To the world he was a beast but for her he would do anything. He could have the world but all he wanted was her. They say the things we want most are the things we can't have. For she was so afraid of him that even the thought of him could have her running for the hills. Little did she know that she was the only one who didn't have to be afraid of him. Credits for the cover go to @Chatachino for the amazing cover.
The Alpha King's Mate by Bookdragon2022
32 parts Complete
"Y-your H-highness? I-i'm sorry b-but t-there m-must b-be a-a m-mistake..." A loud growl sounded through the whole ballroom causing me to start shaking and a whimper to escape my lips. This caused the King to stop growling. He pulled me to his chest and yelled out to the whole ballroom. "MINE!" Audrey is an Omega in the Rapid River Pack. Lucas is the Alpha King, Ruling over all and his own pack, The Moonlight Eclipse Pack. Audrey is beaten daily loosing all hope of every meeting her mate. Lucas just wants his mate but feels like she doesn't exist. What happens when the two meet at the Annual Lunar Eclipse Ball? Credits to @M_Rainberry for the amazingly wonderful cover!!!
The billionaire want me ♡ {Completed} by LovelyShifah
42 parts Complete
"Give me your hand." He ordered and i looked at him confused. He sighed before taking my left hand. I gasped when he suddenly put an engagement ring around my finger. "S-so you knew about t-the contract?" I asked and he nodded. "Now there is no going back." He said going back inside leaving me shocked on my spot. Grace Silver, the daughter of a well business man Rick Silver. She works for her dad and called him Sir instead of dad. She was use being invisible infront of her parents and work most of the time. Xavier knight, a powerful billionaire who saw Grace at one meeting and wanted to make her his. He make a contract to make her her wife and she accepted. What will happen next? Read the book to find out. P.s thanks for choising my book. You can also check out my other book and hopefully you will like them. Please leave a Vote , comment and share❤
I Was Never Yours by JessGirl93
42 parts Complete
When Arianna marries billionaire Zach Price to save her family, she doesn't expect to fall in love with a man who'd always consider her a second choice. An unexpected turn of events brings the couple closer together, but can a marriage based on lies and deceit ever survive? ***** When Arianna's older sister, Olivia, decides to run away on the day of her wedding, Arianna is forced to take her place to save her family from ruin. But her new husband is angry, heartbroken, and seems to hate her guts. The cold, elusive billionaire Zach Price has never quite struck Arianna as the kind of man she'd want to spend her entire life with. She was more than content with her sweet, thoughtful boyfriend Noah, but when circumstances force them together, Zach and Arianna's hearts get entangled in a way she never saw coming. As the couple grows closer, they must battle the demons of their past and of the lives they left behind - especially when Olivia returns and decides she wants Zach all for herself. Content/Trigger Warning: This story contains scenes of violence and sexual abuse, and mentions abortion and miscarriage. [[word count: 100,000-150,000 words]] Cover designed by Ren Tachibana
Hired To Love by JordanLynde
66 parts Complete Mature
Henley agrees to pretend to date millionaire Bennett Calloway for a fee, falling in love as she wonders - how is he involved in her brother's false conviction? ****** Henley Linden's brother is in jail for a crime he didn't commit, and she'll take any job to raise the money needed to free him. Soon, she's agreed to pretend to date millionaire Bennett Calloway for ten thousand dollars, so his mother will ease up the pressure on him to find a wife. But once Henley is enmeshed in Bennett's world, he falls for her, and she starts to have feelings for him as well. Despite her romance with Bennett, as she grows closer to the Calloways, Henley realizes they are somehow involved in her brother's conviction. Journeying deeper into a world of wealth and conspiracies, Henley is forced to rely on Bennett, though doing so could cost her everything. [[word count: 200,000-250,000 words]]
My Fake Boyfriend by ToTheExtreme95
134 parts Complete
He was so close, his breath hit my lips. His eyes darted from my eyes to my lips. I stared intently, awaiting his next move. His lips fell near my ear. "Shut up and kiss me" He whispered roughly. A chill shot up my spine. I pulled back, staring at his eyes and leaned in.. ********** What happens when Alexis Dawson- "residential loser" of Redwood High, agrees to help Redwood High's player, Aaron Walker. How can she stop herself from falling for him? But it isn't all love and romance, Alexis has her own secret. Join them on the journey filled with jealousy, betrayal, trust, friendship and love. A little favour just got a whole lot more complicated.
You may also like
Slide 1 of 9
MISTRESS OF FLAME cover
The Exiled Alpha | ✓ cover
The Boyfriend App cover
The Beast cover
The Alpha King's Mate cover
The billionaire want me ♡ {Completed} cover
I Was Never Yours cover
Hired To Love cover
My Fake Boyfriend cover

MISTRESS OF FLAME

82 parts Complete

[ BOOK 1 OF AZITERA: YTHER'S QUEEN ] Consumed by avarice, the four human kingdoms-the Infernal Empire, the Kingdom of Caelum, the Kingdom of Treterra, and the Nayale Archipelago-betrayed their covenant with Yther of Azitera, the race blessed by deities, who protected humans for untold centuries. They slaughtered and defiled the beings that once protected them from storm, famine, poverty, and pestilence without mercy. Betrayed by the humans they protected, the Ytherians were enslaved. Their four queens were caged, chained, and imprisoned to serve as nutrients to the human kingdoms. The once prominent Ytherians were reduced to nothing but servants. As the four kingdoms of the human race prospered for many years since their betrayal, one news staggered them, causing them to tremble in fear and rally their armies to protect and defend their domain: Sollel-the Mistress of Flame, one of Yther's queens-had escaped her prison. Her flames will raze hell, ready to burn the souls of her betrayers. COMPLETED CECELIB | C.C. COVER: ASTRID JAYDEE

More details