Story cover for Off Limits [GL-Sapphics] by Storytellersoul15
Off Limits [GL-Sapphics]
Storytellersoul15
  • WpView
    Reads 239
  • WpVote
    Votes 51
  • WpPart
    Parts 7
  • WpHistory
    Time 1h 3m
  • WpView
    Reads 239
  • WpVote
    Votes 51
  • WpPart
    Parts 7
  • WpHistory
    Time 1h 3m
Storytellersoul15
Ongoing, First published Jul 20
ardellafoundfamilyfriendsandfamilyfriendshipgaykissergirlxgirlgllayceeromancewlwwomanxwoman
She thought it was just a childhood crush. But eight years later, Ardella Fran Hernandez still feels the same way, maybe even more. The problem? Laycee Jude Davis is her older brother's best friend. The girl who once called her "Lala" and "Baby sis" was the one she was never supposed to fall for.

Now that they've crossed paths again, Ardella has to face a truth she tried to forget: It was never just a phase.





DISCLAIMER: This is written in Taglish
All Rights Reserved
ardellafoundfamilyfriendsandfamilyfriendshipgaykissergirlxgirlgllayceeromancewlwwomanxwoman
Table of contents

7 parts

Sign up to add Off Limits [GL-Sapphics] to your library and receive updates
or
Content Guidelines
You may also like
Where The Light Went by CrushdConfessions
62 parts Ongoing Mature
Bree doesn't do love anymore. Not since the accident. Not since the life she built was taken from her in the quiet blink of a moment. Now she keeps things simple. Drinks too much. Sleeps with women who don't ask questions. Keeps her heart buried somewhere between a barstool and the back porch. Then Harper comes back. The girl from summers past. The one who knew her before the world got sharp. Bree tells herself it's nothing. Just a ghost of a friendship. A familiar face passing through. But something's shifting. And the more she tries to ignore it... the more it demands to be seen. Some wounds don't scar over. Some hearts don't stay buried.
Bound by Love by mhxohxohx47
13 parts Complete
In the bustling halls of their high school, Bella Rosa and Alexa Richards navigate the complexities of friendship, love, and self-discovery. Bella, the kind-hearted cheerleading captain, hides a secret she's not ready to confront: her burgeoning feelings for her best friend, Alexa. Meanwhile, Alexa, known for her outspoken nature, harbors a long-standing crush on Bella, kept hidden beneath a facade of confidence. As Bella grapples with her emerging sexuality and fears of rejection, Alexa struggles to find the courage to reveal her true feelings. When their friends inadvertently discover Alexa's crush, they embark on a mission to help Bella uncover her own desires, leading to a series of heartwarming and humorous misadventures. But their journey takes a tumultuous turn when Bella's estranged brother, Alejandro, returns unexpectedly, reopening old wounds and driving a wedge between Bella and her family. As tensions rise and secrets unravel, Bella and Alexa must confront their deepest fears and insecurities, leaning on each other for support as they navigate the turbulent waters of adolescence and love. Through laughter and tears, victories and setbacks, Bella and Alexa learn that true love knows no bounds and that the most important journey is the one that leads to self-acceptance and authenticity. 'Whispers of Love' is a heartfelt tale of friendship, romance, and the transformative power of embracing who you truly are
In The Backseat by iamtouhou
15 parts Ongoing Mature
Roommates by chance, sparks fly immediately-but not in the way anyone expects. Calitrope dismisses Venici as a cute, easily manipulated plaything, someone to tease, maybe charm, then move on from. But as days melt into weeks, Calitrope finds herself inexplicably drawn to Venici's stubbornness, her intelligence, the way her cheeks flush when Calitrope pushes her buttons. Venici, for her part, knows she should resist the flirtatious allure of her rebellious roommate, yet her heart betrays her. The tension between them grows slowly, heated glances exchanged across their shared space, casual brushes of skin that linger longer than they should. As Calitrope finds herself caught between the intoxicating thrill of control and the undeniable pull of something deeper, Venici realizes that the fierce competition between them might just be the one thing keeping Calitrope coming back-and maybe, just maybe, there's more to their banter than either of them are willing to admit. Neither is willing to make the first move, and yet, in the backseat of that Mustang, things might finally come to a head. It's not just about winning anymore-it's about giving in.
Miss, Do I Know You? by reneesteinberg
47 parts Complete Mature
A stranger to her own existence, Kayla moves to a small town with the hope of finding comfort in a fresh start. But as she steps inside the unfamiliar classroom on the first day, standing in front of the class is a mysteriously familiar face, one that rouses memories of a time she believed had gone by. With past baggage catching up in the most intrusive ways, she stumbles upon unexpected comfort of friendship, unconditional love of found family, and a beautiful yet complicated bond between two hesitant souls. "This book was like a warm hug, and I might believe in love again." "I would give everything, especially my soul, to have the opportunity to read this book for the first time again." ────── CW: Substance abuse, harsh language, sexual content, mention of self-harm and suicide. ────── Started in January 2018. Re-published in November 2022. First draft finished in April 2023. ────── Copyright 2018 © Renee Steinberg All rights reserved. This work may not be reproduced, copied, translated, or republished in any form without the author's permission, except for brief quotations or reviews with proper credit.
One Week Older: Turning Pages ✔️ by AyaBethly
52 parts Complete
"Today, however can change things for better or worse. The outcome depends on you." When a marriage fails, the residue trickles down to everyone in the family. Sixteen-year-old Daya Nicole Johnston must fight to understand what is happening in her life. The revelations about her father surprise her, her brother is becoming distant, her mother is a shell of her former self, and her best friend will not talk to her. To complicate things further, she finds herself caught in a love triangle that pulls at her heart. These events turn her life on its head. How will she cope? And what will she do to combat this? Book 1 in the One Week Older series *Completed October 25, 2019* *Revised July 2024* Cover by comicstvr
Extra Credit by Xmintflake
56 parts Complete
"Why do you always avoid my questions?" "I'm not, it's just that there's nothing to say. Who would ever want to date someone they can't even talk to? It's not rocket science. My eyes are weird, and people get tired of me eventually. There's your one-page essay. Now please don't snow me to death .-." "What? All that you just said is a lie. And I should snow you to death for even saying that! I would definitely date you." "...Thanks." 🍒｡･ﾟ♡ﾟ･｡🍓｡･ﾟ♡ﾟ･｡ Dallas Addison had it all; being a talented swimmer and dating the star of the football team, she didn't think she lacked anything in any capacity. Sure, she and her boyfriend had minuscule issues, but which logical relationship didn't have their occasional ups and downs? After landing in Extra Credit class due to a series of mishaps with her grades and attendance, Dallas's turmoil became despair when she became paired with one of the most eccentric people in the entire class. Seriously. Who wore sunglasses to school, much less indoors? When weeks turned into months of working together, series of back-and-forth message threads started to hit closer and closer to home. Suddenly, Dallas realized that maybe her life wasn't as idyllic as she was previously led to believe. || Completed 2023 ✔️ || ©ReeseTory2022
A slow fall by paiigess
33 parts Ongoing
Caleb wasn't sure who he was. His parents told him one thing, the Church, the people in town, but his brothers, friends, life outside, was a different story. With his brother's both away for University, Caleb was stuck in a downward spiral that he wasn't sure he could escape from. Enter Lucas. The neighbour who'd always been there, but their friendship was surface level-Caleb was certain Lucas' only saw him as his best friends little brother. After bumping into Lucas at a club, a stronger friendship quickly forms. He finally learns more about Lucas than he ever knew, but he didn't stop to think about how that could go both ways. Maybe that's just what Caleb needed though, someone to see more than what was on the surface. Maybe the love he sought was right there in front if him, and so was the help he needed. --- *This is a bxb that deals with sensitive themes and mature subjects. Read with care.*
Catching Rainbows by FairlyLocalTreehouse
42 parts Complete
Luna falls for Chloe at first sight . . . literally, off a ladder. And it's the beginning of a beautiful friendship, after Luna gets past the fact that Chloe doesn't seem to be single. They soon discover all the things they have in common, their time spent together a much-needed solace to both girls, and the feelings they develop for each other are undeniable. It quickly becomes evident however that all is not as it seems; Chloe is in fact trapped in her farce of a relationship, and Luna vows to help her new friend escape the toxic situation and find her way back to herself.
silent longing by junemail
25 parts Complete
Lila has always been content to stay in Raine's shadow, her love hidden behind a veil of friendship. But as summer unfolds, unspoken feelings threaten to surface, and Lila must decide whether to risk everything for a love that might never be returned. Some hearts are meant to break quietly.
Kinda Crushing: High School by silentquill_
9 parts Ongoing
He's her brother's best friend. He's supposed to be off-limits. So why does her heart keep tripping every time he's around? At Arden High, Ela never planned on falling for the boy who only sees her as a kid. But one school year can change everything. Tropes: ✨️Older Brother's Best Friend ✨️High School Romance ✨️Senior x Junior Book I Of Duology
You may also like
Slide 1 of 10
Where The Light Went cover
Bound by Love cover
In The Backseat cover
Miss, Do I Know You? cover
One Week Older: Turning Pages ✔️ cover
Extra Credit cover
A slow fall cover
Catching Rainbows cover
silent longing cover
Kinda Crushing: High School cover

Where The Light Went

62 parts Ongoing Mature

Bree doesn't do love anymore. Not since the accident. Not since the life she built was taken from her in the quiet blink of a moment. Now she keeps things simple. Drinks too much. Sleeps with women who don't ask questions. Keeps her heart buried somewhere between a barstool and the back porch. Then Harper comes back. The girl from summers past. The one who knew her before the world got sharp. Bree tells herself it's nothing. Just a ghost of a friendship. A familiar face passing through. But something's shifting. And the more she tries to ignore it... the more it demands to be seen. Some wounds don't scar over. Some hearts don't stay buried.

More details