Story cover for A Trickster's Gambit by KingofKingofAngels
A Trickster's Gambit
KingofKingofAngels
  • Reads 18
  • Votes 1
  • Parts 1
  • Time 13m
  • Reads 18
  • Votes 1
  • Parts 1
  • Time 13m
KingofKingofAngels
Ongoing, First published Sep 30
1 new part
actionfantasyhorrorlovecraftianmagicmetaphysicalmysteryromance
A man who is both a god and a mortal plunges into a crater of monsters, an eternal smile plastered on his sculpted face.

An empress born of misfortunes stirs within her eternal slumber even as her heart is pierced by a strangely shaped spear of crimson red ruby.

A frantic worker at an unknown location in an unknown situation hurriedly sent out a single telegraph to an unknown receiver, the entirety of the message a single string of numbers.

"12-5.5-5.0.1-5.8.8-5.9.12-5.8.4-5".
All Rights Reserved
actionfantasyhorrorlovecraftianmagicmetaphysicalmysteryromance
Table of contents

1 part

Sign up to add A Trickster's Gambit to your library and receive updates
or
#2lovecraftian
Content Guidelines
You may also like
10-Feet Sea God And His 5-Feet Human Bride by Srainrain
79 parts Ongoing
For over a thousand years, the Sea God has ruled the endless oceans, his power feared by mortals and worshipped by kings. His storms shape empires, his tides decide the fate of nations. Yet beneath his immortal strength lies a single, unfulfilled desire-an heir. He has crowned countless Sea Queens, each one chosen for her beauty, her magic, her divine blood. And each one has failed him. The sea remains silent, barren, and his throne grows colder with every passing century. Until one night, against every law of nature and every curse of the gods, a fragile human girl carries his child. She is everything he despises-mortal, weak, fleeting. He has drowned cities for less than a whisper of human defiance. And yet, inside her grows the one thing he has longed for more than power, more than eternity itself. Now, torn between hatred and desire, vengeance and hope, the Sea God must choose: Will he destroy the girl who embodies everything he loathes... Or protect the fragile spark of life that could finally break his eternal loneliness? A tale of forbidden love, divine wrath, and the one bond strong enough to shake the heavens-the bond between father and child.
Parables Of Jesus Christ by KerrieWhite
43 parts Complete
A collection of some of the parables of jesus. This is of my own interpretation. Enjoy. The study has been complied from personal and various sources from the internet. None of the sites used have copyright and are all public domain. No copyrights have been broken
Beast World Handsome Husband Hoarder by HunterKxezshieOffcl
82 parts Ongoing
×Mature× > She died a jobless anime binge-watcher. She woke up a chubby, unwanted beast bride. Odette didn't ask for a second life-especially not in the body of a despised gray swan with five drop-dead-gorgeous beastmen husbands who can't even look her in the eye. Forgotten by her tribe, accused of crimes she didn't commit, and left to drown by the very men who vowed to protect her... it should've ended there. But fate-no, a shady cosmic system-had other plans. Armed with a cheat-like storage space, a secondhand body, and five cold marks on her hand proving none of her husbands ever claimed her, Odette decides it's time to rewrite this beastly romance into her own personal revenge story. Who needs loyalty when she can hoard hotter husbands? Who needs love when she can live deliciously petty? Let the ex-husbands regret. Let the new suitors line up. And let the Swan Queen rise-feathers, fat rolls, and all.
Soulful Love / Yizhan (ongoing) by _Dhuni_
68 parts Ongoing
භවයෙන් භවේ පතා ආදරේ.... සදාකල් සුවඳයි.....🥀🤍
Landrew: MY EX'S GUY FRIEND by Theyluvmia_12
8 parts Ongoing
just a little Landrew fanfiction for people who ship Andrew and Lexi just like I do In the meantime, Enjoy the story! :)
I See The Light : A Sonamy ♡ Story by sonamyfanlover
23 parts Complete
my first story and sonamy story so i hope you guys enjoy and like it and i hope i didnt so bad. Description: Amy has liked sonic for the longest time. So what happens when she sees the love of her life with someone else?
Beneath The Emblem by whoreforredflags
73 parts Ongoing
There is a kind of silence that comes just before thunder-heavy, suffocating. That was the silence in Sahastra Tripathi's heart. He had walked away from privilege and power-for love. For Sparshika. But she wasn't Sparshika. She was Urvi. And everything he had abandoned was now burning behind him. "What happened, Urvi? Did you forget your name or think I was a fool?" "I... I was going to tell you-" Two strides. He grabbed her hair. CRACK! Her head slammed into the kitchen counter. Plates shattered. She cried out, collapsing, blood gushing from her forehead. "Sahastra ji!" she whimpered. He yanked her back up. SLAP! Her cheek snapped sideways. She fell again, lip split open. "Please don't hit me..." He pressed his shoe on her cheek, grinding it into the marble. "You lied to me. Your name, your past-everything was a lie." "No... I love you!" He crouched, grabbed her face. His eyes burned. "My father was on the brink of death... because of you." She blinked, stunned. "What?" "Still pretending?" SLAP! She hit the floor again. "I really don't know..." He didn't let her finish. He lifted her, threw her over his shoulder, stormed into the bedroom and threw her onto the bed. His belt came off. He tied her wrists to the bedposts-tight, ruthless. He crouched again, jaw clenched. "Because of you, my father is in this condition." "You gave away his location, didn't you?" "But too bad... he survived." "But now he can't walk. And neither will you." He grabbed her foot-twisted. CRACK! She screamed. He smiled darkly. "Don't stop screaming. Your pain soothes me." He grabbed her other foot. Twisted-slow, calculated. Stopped just before the break. "I could break it... but not yet." "I'll break you. And your legs. Slowly." He stood, breath ragged. Eyes hollow. "Just like my father can't walk... you never will." He turned, slammed the door. Urvi lay tied, broken, bleeding. She could no longer tell what hurt more-her body, or her heart.
Embarrassing and Funny stories by __Honey_Lemon
9 parts Complete
Read these embarrassing stories.
Stranger Things Season 4 by ChristmasLightThings
18 parts Complete
AN ALTERNATIVE ST STORY- Jam-pack full of dark, abnormal and creepy events but remains exhilarating, bright and playful. There are heaps of BIG surprises in this online book which you won't expect! A creative, clever, unique and innovative version of the fourth season of the hit show Stranger Things!!! THERE IS MALL TO THE STORY............... The story continues as it is 1986. School's out for Spring break! Starcourt Mall is the place to be and Eleven and the Hawkins crew are trying to move forward from the previous year as they figure out how to grow up without growing apart. Meanwhile, Joyce deals with Hopper and Murray, as new horror rises and threatens the small town once again. New and old faces join the adventure not only in Hawkins, Indiana but outside in the cities of Boston and Ohio. The new Mall shares surprises-both supernatural and human. Something is off about the town's residents as they act like sickening zombies and despite having closed most of the gates in previous times, the old one at the Hawkins Lab reopens to the horrendous Upside Down and everyone fears that they are all in danger from it again. Evil never ends; it 'evolves'. (Disclaimer: I DO NOT OWN THE CHARACTERS OF STRANGER THINGS, THEY BELONG TO THE DUFFER BROTHERS AND THE PRODUCERS OF THE SHOW. However, I did create my OC's and other things...)
Us Two [Completed] by Hanamii_Ji
28 parts Complete
||240621|| ||240808|| မိခင်နှစ်ဦး စီစဉ်ပေးမှုကြောင့် ကြင်ဖက်သွားတွေ့ရင်း ဆုံကြတဲ့ ကောင်လေးနှစ်ယောက်။ စံလင်းသူကို ကြင်ဖက်အဖြစ် မတွေ့ခင်က မြင်ဖူးပြီး စိတ်ဝင်စား‌နေတဲ့ မင်းခန့်ပိုင်ဖြိုး။ သို့သော် မင်းခန့်က စံလင်းကို သူ့ထက်အငယ်လို့ ထင်နေခဲ့တဲ့အပြင် သူတွေ့ရမယ့် ကြင်ဖက်ကလည်း စံလင်းသူမှန်း သိသွားသောအခါ.. Minn Khant Paing Phyo × San Linn Thu [Own Creation] ******************* မိခင္ႏွစ္ဦး စီစဥ္ေပးမႈေၾကာင့္ ၾကင္ဖက္သြားေတြ႕ရင္း ဆုံၾကတဲ့ ေကာင္ေလးႏွစ္ေယာက္။ စံလင္းသူကို ၾကင္ဖက္အျဖစ္ မေတြ႕ခင္က ျမင္ဖူးၿပီး စိတ္ဝင္စား‌ေနတဲ့ မင္းခန္႔ပိုင္ၿဖိဳး။ သို႔ေသာ္ မင္းခန္႔က စံလင္းကို သူ႕ထက္အငယ္လို႔ ထင္ေနခဲ့တဲ့အျပင္ သူေတြ႕ရမယ့္ ၾကင္ဖက္ကလည္း စံလင္းသူမွန္း သိသြားေသာအခါ.. Minn Khant Paing Phyo × San Linn Thu [Own Creation]
You may also like
Slide 1 of 10
10-Feet Sea God And His 5-Feet Human Bride cover
Parables Of Jesus Christ cover
Beast World Handsome Husband Hoarder cover
Soulful Love / Yizhan (ongoing) cover
Landrew: MY EX'S GUY FRIEND cover
I See The Light : A Sonamy ♡ Story cover
Beneath The Emblem cover
Embarrassing and Funny stories cover
Stranger Things Season 4 cover
Us Two [Completed] cover

10-Feet Sea God And His 5-Feet Human Bride

79 parts Ongoing

For over a thousand years, the Sea God has ruled the endless oceans, his power feared by mortals and worshipped by kings. His storms shape empires, his tides decide the fate of nations. Yet beneath his immortal strength lies a single, unfulfilled desire-an heir. He has crowned countless Sea Queens, each one chosen for her beauty, her magic, her divine blood. And each one has failed him. The sea remains silent, barren, and his throne grows colder with every passing century. Until one night, against every law of nature and every curse of the gods, a fragile human girl carries his child. She is everything he despises-mortal, weak, fleeting. He has drowned cities for less than a whisper of human defiance. And yet, inside her grows the one thing he has longed for more than power, more than eternity itself. Now, torn between hatred and desire, vengeance and hope, the Sea God must choose: Will he destroy the girl who embodies everything he loathes... Or protect the fragile spark of life that could finally break his eternal loneliness? A tale of forbidden love, divine wrath, and the one bond strong enough to shake the heavens-the bond between father and child.

More details