Story cover for The Moon and the Tide (Seamoon Fanfic) by TheQueenOfAllAxolotl
The Moon and the Tide (Seamoon Fanfic)
TheQueenOfAllAxolotl
  • WpView
    Reads 124
  • WpVote
    Votes 21
  • WpPart
    Parts 9
  • WpHistory
    Time 14m
  • WpView
    Reads 124
  • WpVote
    Votes 21
  • WpPart
    Parts 9
  • WpHistory
    Time 14m
TheQueenOfAllAxolotl
Ongoing, First published Oct 10
cookieruncookierunkingdomcrkdramafamilyfriendlygayhappylesbianlgbtqiamoonlightmoonlightcookienosmutromanceseafairyseafairycookieseamoonsillyslowbrunslowburnstinkyfrostqueencookie
Family Friendly!
No smut,Cuss words, or sensitive topics
Have fun!
No hate, only constructive criticism
Enjoy!
:3
OK YALL STOP ASKING ME IF YOU CAN MAKE COVERS OR HELP ME PROMOTE PLS!! I DON'T GIVE OUT MY INFO TO OTHERS, THIS HAS HAPPENED LIKE 8 TIMES I CAN'T GIVE OUT INFO IM SORRY JUST STOOPPPPPPPPPP, YOUR COMMENT WILL BE DELETED!!!
Public Domain
cookieruncookierunkingdomcrkdramafamilyfriendlygayhappylesbianlgbtqiamoonlightmoonlightcookienosmutromanceseafairyseafairycookieseamoonsillyslowbrunslowburnstinkyfrostqueencookie
Table of contents

9 parts

Sign up to add The Moon and the Tide (Seamoon Fanfic) to your library and receive updates
or
#48seamoon
Content Guidelines
You may also like
𝙐𝙣𝙫𝙚𝙞𝙡𝙚𝙙 𝙋𝙧𝙤𝙢𝙞𝙨𝙚𝙨 - 𝙎𝙝𝙖𝙙𝙤𝙬 𝙊𝙛 𝙑𝙤𝙬𝙨 by Deewanixwriters
82 parts Ongoing
AKSHAT SINGHANIA - A literature professor in Singania Institute of Arts and Commerce. He is soft and caring person with a tough exterior, who doesn't believe in love or marriage because of his parent's broken relationship and his ex wife's betrayal. As a professor, he's dedicated to his work, and his no-nonsense attitude masks a softer side. AMRIT TRIPATHI - She is a straightforward but introvert student, embodying simplicity and honesty. While others vie for the attention of their stern professor, Akshat, Amrit remains unnoticed until life takes an unexpected turn. Her future dream is to become an writer and she is starting her PHD. However their fates intervened when Akshat had to marry Amrit for saving her from humiliation. Jump inside to join their journey ✨
Where Did You Go, My Love? - Astro x Dandy (Moonflower) by moonflowerenthusiast
8 parts Ongoing
Dandy has had the ichor production ongoing for a long while now.. !ART NOT MINE! this is my first fanfic..
𝙃𝘼𝙏𝙀𝙁𝙐𝙇 𝙃𝙐𝙂𝙎 by GloomyAzella
25 parts Ongoing
Gardenview has been left to rot for years now. And when another supply run comes around the day again, things go horribly wrong in all of the worst ways - Dealing With Guilt, anger, and shame, the toons now have to step around this tricky situation with the un-needed "help" of a old face to greet them in the finale. ... how many bad things can happen in one week again?
The Hollow Head Brothers | The Chronicles | by Rain_the_potato
18 parts Ongoing
I'm bored and invested in Stickmen on the internet.
Shadows of Darkness - DANDY'S WORLD AU by SpyFoxHere
24 parts Ongoing
Dandy and Vee have always been enemies - they'd constantly be at eachother's throats, whether it was over something small or the opposite. Yet as a new arrival shakes up the abandoned museum of Gardenview, they find that they have to work together to stop this new threat, once and for all. ____ Warnings and ships in book! This isn't Dandy x Vee btw but if you want you can view it like that :/ This is my AU! Most characters aren't owned by me. All art is mine. I take constructive criticism!
Bleach: New Generation by IgristheGOAT
77 parts Ongoing
Kazui Kurosaki, a 17 year old in Karakura High, is not as normal as a regular high school student. Like his father Ichigo, he is a Substitute Soul Reaper who possesses incredible power. During his days casually purifying Hollows with the new Soul Reaper and best friend, Ichika Abarai, it seems that there's been a disaster in the Soul Society. Byakuya Kuchiki and Renji Abarai have disappeared completely, and the Soul King is slowly dying. With the powers that Kazui has, he'll have to become stronger to help save the worlds and protect everyone and recall the past to reach greater heights. This is my first story so give me feedback if you can. Yes I read the manga, no I didn't read the light novel so some stuff I'll just make up or search up. I'll add some OC's for some characters. Weekly uploads, expect chapters on weekends. Share with other Bleach fans so that this can get more support. (Edit: It starts off short cuz I wasn't that confident with my writing, but the more recent chapters get better.) (Edit 2: If you're wondering why theres like so many chapters, its because its just like real Bleach. The pacing in this one is meh but its worth it) If it wasn't obvious already, I do not own Bleach, it belongs to Tite Kubo. The cover art made by @rexx002 from Pinterest or Twitter/X and any other images have been taken from the internet and not my own. Anyway, Enjoy!
The Everything: Integration (Sci-Fi Alien Invasion? Story) by Vexxen0
61 parts Ongoing
Earth, our home. But... something is wrong. As the nature of reality makes itself known, watch earth react, and change, with fear, hate, progress, and love. To the grand events the universe has in store for earth. As the world changes, as the universe revivals aliens exist, but not the world ending kind. As humanity realizes... perhaps the universe is too good for us. --- A story within The Everything canon, a foundation to it. This is a passion project, and I'm still developing my writing style, so feedback is welcome! If you create fan art, I'd be happy to include it (with credit). I am not willing to pay for art, or new covers at this time. The current cover may replace if I get something better. Contact Me: https://discord.gg/6nWpaDNKhY
Back to the Future part IV by MikeNichols74
13 parts Complete
Marty McFly's travels through time shaped his future and his life with Jennifer couldn't be happier. 2015 turned out to be a bit different to the one he saw as a teenager. One big surprise was when their unexpected third child, Scott came along in the year 2000. Fifteen years on and he's every bit the chip off Marty's block; especially when he learns about the events of October 21st 2015...
Static Dinosaurs and Unspoken Hearts |ShellVision| by OnyxGhost27
28 parts Ongoing
Vee enjoys spending time with her friends, but every time she sees Shelly, new emotions stir inside her-emotions she's never felt before. With each encounter, Vee discovers a deeper connection, one that pulls her in with tenderness and longing, leaving her to wonder if the universe has brought them together for a reason. She doesn't understand why she feels like this everytime, but Shelly never knew... But just when Vee thinks she's figured it out... Shelly's next smile leaves her heart racing-and for the first time, Vee wonders if she's falling for someone who might never feel the same. (THE ART IS NOT MINE!! CREDIT GOES TO THE ARTIST)
A chaotic crossover!! [an animaticlock fic] by ClocksClocked
17 parts Complete
With all the portals showing up in itft, we've gotta see where at least one of them goes! - A fic about objects that are gay. Yay! [Main characters belong to greenyguy and derpadon, other characters who may or may not appear belong to sacri and whoever made bfdi. I forgot his name tbh] - [Ships included: animaticlock, which will be the main focus of this fic, exclastar, starvase, ninetile, some others] - [Other fandoms I may or may not be mentioning in this fic: objectified, LOTS, xfhov/bfdi, tnm, obs, BURNER, more references when I think of them]
You may also like
Slide 1 of 10
𝙐𝙣𝙫𝙚𝙞𝙡𝙚𝙙 𝙋𝙧𝙤𝙢𝙞𝙨𝙚𝙨 - 𝙎𝙝𝙖𝙙𝙤𝙬 𝙊𝙛 𝙑𝙤𝙬𝙨 cover
Where Did You Go, My Love? - Astro x Dandy (Moonflower) cover
𝙃𝘼𝙏𝙀𝙁𝙐𝙇 𝙃𝙐𝙂𝙎 cover
The Hollow Head Brothers | The Chronicles | cover
Shadows of Darkness - DANDY'S WORLD AU cover
Bleach: New Generation cover
The Everything: Integration (Sci-Fi Alien Invasion? Story) cover
Back to the Future part IV cover
Static Dinosaurs and Unspoken Hearts |ShellVision| cover
A chaotic crossover!! [an animaticlock fic] cover

𝙐𝙣𝙫𝙚𝙞𝙡𝙚𝙙 𝙋𝙧𝙤𝙢𝙞𝙨𝙚𝙨 - 𝙎𝙝𝙖𝙙𝙤𝙬 𝙊𝙛 𝙑𝙤𝙬𝙨

82 parts Ongoing

AKSHAT SINGHANIA - A literature professor in Singania Institute of Arts and Commerce. He is soft and caring person with a tough exterior, who doesn't believe in love or marriage because of his parent's broken relationship and his ex wife's betrayal. As a professor, he's dedicated to his work, and his no-nonsense attitude masks a softer side. AMRIT TRIPATHI - She is a straightforward but introvert student, embodying simplicity and honesty. While others vie for the attention of their stern professor, Akshat, Amrit remains unnoticed until life takes an unexpected turn. Her future dream is to become an writer and she is starting her PHD. However their fates intervened when Akshat had to marry Amrit for saving her from humiliation. Jump inside to join their journey ✨

More details