Story cover for 💔 The Mask of Yukio💔 [short story] by su1c1de_master
💔 The Mask of Yukio💔 [short story]
su1c1de_master
  • WpView
    Reads 4
  • WpVote
    Votes 1
  • WpPart
    Parts 9
  • WpHistory
    Time 12m
  • WpView
    Reads 4
  • WpVote
    Votes 1
  • WpPart
    Parts 9
  • WpHistory
    Time 12m
su1c1de_master
Complete, First published Nov 01
9 new parts
basedonatruestoryfakesmilefastfemaleleadhappyendingjourneylifeoriginaloriginalcharactershortstorystraightcouplestrongcontentteen
This story is more on Keis point of view.


Yukio, the most popular girl in high school, expertly hides her feelings with a bright smile. Only Kei, a boy who has a crush on her, senses her secret, but she denies it.
The painful truth surfaces after she is violently attacked. Finally vulnerable, Yukio confesses her hidden life to Kei, leading to a story of survival and the beginning of her unconditional healing.



original characters!!
SHORT STORY!!!
All Rights Reserved
basedonatruestoryfakesmilefastfemaleleadhappyendingjourneylifeoriginaloriginalcharactershortstorystraightcouplestrongcontentteen
Table of contents

9 parts

Sign up to add 💔 The Mask of Yukio💔 [short story] to your library and receive updates
or
#414femalelead
Content Guidelines
You may also like
💞THE GUILTY HEARTS .💞The Fault In Our Stars 💖 by LadyLeopard
78 parts Ongoing
This Is A Different Story. Book 1 completed.and Now Book 2 is going to be starting. 1). what if jayjay's father JASPHER MARIANO was the one here about the section e's plan when that time? 2). what if jeana Fernandez and jaspher mariano remarried? 3). what if after keifers return jay suddenly disappeared from HVIS and PHILIPIAN 4). After one month keifer and section e saw jay in a Halloween party with a man who was kissing her cheek .and she called him her own boyfriend 5). what if keifer turns a beast watson in that party 6). what if keifer try to do something wrong to jay 7). is this girl is our section e's mutya ? their doubt if she is not jay who was that girl ? is she related to jay . 8). after one month jays back to HVIS .but why section e is not chasing her ignoring her . why suddenly keifer started to hate her . didn't follow her
The Prodigy | ✔︎ by EroticMarie
68 parts Complete Mature
"The Hacker and the Mob Boss" ❦ Reyna Fields seems to be an ordinary girl with her thick-framed glasses, baggy clothes, hair always up in a ponytail, and her head tucked away behind a computer screen. However, no one knows she's armed with a genius IQ and a heart of gold. She hacks her way into virtual systems on a search for her mother. Unfortunately for her, she has hacked into the wrong database. She hacked into the database of the notorious mob boss, Santino "Saint" Venturi. Saint is the opposite of his name. He's known for his ruthlessness. As a mob boss to a mafia, he learned to eat or be eaten. When Reyna stumbles upon his database, a plan dispersed into his mind. He's going to take her. ❦ "I don't share, angel." "He's a friend," she found herself saying. Dante was too busy staring at her to notice the fiery glare in Saint's eyes. She was mentally praying that Dante would just look away. His fingers trailed up her leg before his hand latched onto her sex. He held her there while a small gasp left her lips. "I will fuck you on this table if he doesn't stop looking at what belongs to me." ❦ HIGHEST RANKING: #5 romance - 6/26/22 Dark Romance Cover by @-simplyhan
𝐇𝐈𝐒 𝐑𝐈𝐕𝐀𝐋, 𝐇𝐈𝐒 𝐑𝐔𝐈𝐍┃ᵗᵃᵉᵏᵒᵒᵏ by tkeevii
16 parts Ongoing
𝐇𝐈𝐒 𝐑𝐈𝐕𝐀𝐋, 𝐇𝐈𝐒 𝐑𝐔𝐈𝐍 - 𝙏𝙪𝙧𝙣𝙨 𝙤𝙪𝙩 𝙤𝙗𝙨𝙚𝙨𝙨𝙞𝙤𝙣 𝙨𝙤𝙪𝙣𝙙𝙨 𝙖 𝙡𝙤𝙩 𝙡𝙞𝙠𝙚 "𝙄 𝙡𝙤𝙫𝙚 𝙮𝙤𝙪" ──★ 𝐓𝐇𝐄𝐘 𝐖𝐄𝐑𝐄 𝐍𝐄𝐕𝐄𝐑 𝐄𝐍𝐄𝐌𝐈𝐄𝐒, 𝐉𝐔𝐒𝐓 𝐁𝐔𝐑𝐍𝐈𝐍𝐆 𝐇𝐄𝐀𝐑𝐓𝐒 𝐖𝐀𝐈𝐓𝐈𝐍𝐆 𝐓𝐎 𝐁𝐄 𝐇𝐄𝐀𝐑𝐃. 𝘏𝘦 𝘸𝘢𝘴 𝘩𝘪𝘴 𝘳𝘪𝘷𝘢𝘭... 𝘉𝘶𝘵 𝘩𝘦'𝘴 𝘢𝘭𝘴𝘰 𝘵𝘩𝘦 𝘳𝘦𝘢𝘴𝘰𝘯 𝘩𝘦 𝘴𝘶𝘳𝘷𝘪𝘷𝘦𝘥. 𝐀 𝐋𝐎𝐕𝐄 𝐒𝐓𝐎𝐑𝐘 𝐅𝐔𝐄𝐋𝐄𝐃 𝐁𝐘 𝐎𝐁𝐒𝐄𝐒𝐒𝐈𝐎𝐍, 𝐏𝐀𝐈𝐍, 𝐀𝐍𝐃 𝐑𝐄𝐃𝐄𝐌𝐏𝐓𝐈𝐎𝐍. ──★ ❝ "I hate you..." ➛ "But I ruined myself for you." ❞ ❝ "I'll protect you, even if you hate me." ❞ ❝ "You think I ever wanted anyone else?" ❞ ❝ "Keep crying, baby. Every tear makes me love you more." ❞ ❝ "You're the only one who could destroy me like this." ❞ ──★ 𝐓𝐎𝐏 ﹒Taehyung 𝐁𝐎𝐓𝐓𝐎𝐌 ﹒Jungkook (fem-bodied) ──★ 𝐖 𝐀 𝐑 𝐍 𝐈 𝐍 𝐆 𝐒 Δ 𝐨𝐛𝐬𝐞𝐬𝐬𝐢𝐯𝐞 𝐥𝐨𝐯𝐞 Δ 𝐞𝐧𝐞𝐦𝐢𝐞𝐬 𝐭𝐨 𝐫𝐮𝐢𝐧𝐞𝐝 𝐥𝐨𝐯𝐞𝐫𝐬 Δ 𝐚𝐧𝐠𝐬𝐭 + 𝐬𝐦𝐮𝐭 Δ 𝐟𝐞𝐦 𝐛𝐨𝐝𝐢𝐞𝐝 𝐉𝐊 (𝐡𝐢𝐦/𝐡𝐢𝐬 𝐩𝐫𝐨𝐧𝐨𝐮𝐧𝐬) Δ 𝐬𝐰𝐞𝐥𝐥𝐞𝐧 𝐧𝐢𝐩𝐬 & 𝐛𝐨𝐨𝐛𝐢𝐞 𝐩𝐥𝐚𝐲 Δ 𝐝𝐢𝐫𝐭𝐲 𝐭𝐚𝐥𝐤, 𝐬𝐨𝐛𝐬, 𝐨𝐰𝐧𝐞𝐫𝐬𝐡𝐢𝐩 Δ 𝐞𝐧𝐝𝐢𝐧𝐠: 𝐥𝐨𝐯𝐞𝐬𝐢𝐜𝐤, 𝐜𝐫𝐲𝐢𝐧𝐠, 𝐭𝐨𝐠𝐞𝐭𝐡𝐞𝐫 ──★ ✨ 𝐃𝐈𝐒𝐂𝐋𝐀𝐈𝐌𝐄𝐑 ✨ This story is fictional.
MISTRESS OF FLAME by CeCeLib
82 parts Complete
[ BOOK 1 OF AZITERA: YTHER'S QUEEN ] Consumed by avarice, the four human kingdoms-the Infernal Empire, the Kingdom of Caelum, the Kingdom of Treterra, and the Nayale Archipelago-betrayed their covenant with Yther of Azitera, the race blessed by deities, who protected humans for untold centuries. They slaughtered and defiled the beings that once protected them from storm, famine, poverty, and pestilence without mercy. Betrayed by the humans they protected, the Ytherians were enslaved. Their four queens were caged, chained, and imprisoned to serve as nutrients to the human kingdoms. The once prominent Ytherians were reduced to nothing but servants. As the four kingdoms of the human race prospered for many years since their betrayal, one news staggered them, causing them to tremble in fear and rally their armies to protect and defend their domain: Sollel-the Mistress of Flame, one of Yther's queens-had escaped her prison. Her flames will raze hell, ready to burn the souls of her betrayers. COMPLETED CECELIB | C.C. COVER: ASTRID JAYDEE
လူဆိုးလေး by pyaeshankha
21 parts Ongoing
လွှမ်းအာဏာရှိန် မင်းကို လူလိမ္မာလေး ထင်ထားတာ လူဆိုးလေးဖြစ်နေတာပဲ အဟွန်း ပိုင်ရှင်းသာ နောက်လိမ္မာပါ့မယ်😁
The Cop Next Door by princess-fill
28 parts Complete
"Stop it, Dax." I wouldn't meet his eyes, I couldn't. His hot breath trailed up my neck, his soft lips ghosting over the exposed flesh. He chuckled when my back arched involuntarily, my cheeks flaring hot and pink. "It's Officer Rivera, to you." His deep voice rasped quietly in my ear. "Besides, you don't want me to stop, Princesa." "If you don't stop, I'll-" "You'll what?" He interrupted, smirking against my jawline. "Call the police?" Jane Kingsley is a Veterinary Medicine major at the University of California-Davis. If she isn't at school, she's either working or lounging around the house she shares with her best friend, Vivian Tyler. Everything in Jane's life was getting back to normal, almost boringly average. But then Officer Daxon Rivera moves in next door. Flirty, sexy, and a total asshole: Officer Rivera is everything Jane wants to stay away from. But can she? -Mature Content within- Ranked #32 in Romance [2-1-2018]
Une nuit à la cité by saa9tounsya
45 parts Ongoing
17 ans, marocaine et turc, Zayira.. une fille complètement perdu sur sa vie, va bientôt être mise à la rue. Elle va faire la rencontre d'un groupe qui va changer sa vie à jamais..
Baby to me by FckIsYouTalmBout
46 parts Ongoing
25 year old Y/N goes out to celebrate her birthday and meets a older fine women who may be a little to mature for her. After one night alone Y/N can't seem to let her go and fights to keep her attention.
The Beast by palepinkferriswheel
52 parts Complete
To the world he was a beast but for her he would do anything. He could have the world but all he wanted was her. They say the things we want most are the things we can't have. For she was so afraid of him that even the thought of him could have her running for the hills. Little did she know that she was the only one who didn't have to be afraid of him. Credits for the cover go to @Chatachino for the amazing cover.
Ex-Husband Turned Boss (Original Version) by deetronite
17 parts Ongoing
Down-on-her-luck Aubrey gets the job offer of a lifetime, with one catch: her ex-husband is her new boss. *** Aubrey Whitlock's life is turned upside down after her divorce, leaving her an unemployed, broke, and single 29-year-old. A chance meeting with her ex throws her for a loop again when he makes her an offer: come work with him as his assistant. Now a self-made billionaire, Bryce Roberts is just as infuriating-and good-looking-as he was the first time around. Their marriage was disastrous, but their chemistry is stronger than ever. Will they ever mend their relationship, or will it be nothing more than a heated game of seduction? And what will happen when Bryce discovers the secrets Aubrey has been keeping from him after all this time?
𝐀𝐬𝐡𝐞𝐬 & 𝐢𝐧𝐤𝐬 by YTBGLOCKAA
31 parts Complete
short story.
His Possession In Discretion | ✓ - DISCRETION SERIES BOOK #1 by iiLoveydoveii
9 parts Complete
Brielle Newman A 21-year-old girl who was struggling to make life comfortable for herself and her niece, Delilah. Her sister left the baby the minute she could get up and leave the hospital. Brielle hasn't seen her since. She also hasn't seen her parents who walked out on her at 17 or her brother who went to the army and hasn't contacted her for 9 months in counting. Being all by herself she's desperately trying to give Delilah a life she never got to experience. Killian Russell A 24-year-old ruthless CEO who doesn't tolerate negligence or stupidity. He wouldn't blink an eye before firing someone who worked for him for years. Make one mistake and you're done. His parents were extremely proud of his success. He never had a stable relationship. He was once a hit it and quit it guy but now he just lays low as most women throw themselves at him just for his money. Being the richest man in the northeast and second richest in the country he has no time for love. When he finds little Delilah ordering a coffee, he follows her out. She takes him to Brielle, who instantly made something click in Killian, changing their lives forever. Disclaimer: This book is more so about fluff, comedy, and drama (I wrote it as a literal teenager). If you are looking for a bit more ✨spice✨, check out the other books within the Discretion Series. WARNING: THIS BOOK CONTAINS MATURE CONTENT AND EXPLICIT LANGUAGE. READ AT YOUR OWN RISK. IF YOU ARE NOT A FAN OF CONTROLLING MEN AND A SEMI-SUBMISSIVE FEMALE LEAD, THIS BOOK IS NOT FOR YOU! I REPEAT, PLEASE DO NOT ENTER THIS BOOK WITH THE INTENTION OF ALREADY NOT LIKING IT AND LEAVING HATE COMMENTS. #2 in Romance - 04/17/18
Secret & Scars by ilmaverse
51 parts Ongoing
𝐁𝐨𝐨𝐤 𝐎𝐧𝐞 𝐢𝐧 ' 𝐀𝐬𝐡𝐞𝐬 & 𝐄𝐦𝐛𝐞𝐫𝐬' 𝐒𝐞𝐫𝐢𝐞𝐬 In a world that screams, I stand in despair, My voice drowned out, lost in the air. Chains of tradition tighten each day, I long to escape, but I'm forced to stay. Each breath I take feels heavy and torn, Every mistake a scar I've worn. I crave a sky where I can be free, Away from the walls that imprison me. For now, I sit with my heart in pain, Silent, yet screaming, again and again. Though shattered, a spark in me still survives, Dreaming of freedom where my soul can rise.
I Was Never Yours by JessGirl93
42 parts Complete
When Arianna marries billionaire Zach Price to save her family, she doesn't expect to fall in love with a man who'd always consider her a second choice. An unexpected turn of events brings the couple closer together, but can a marriage based on lies and deceit ever survive? ***** When Arianna's older sister, Olivia, decides to run away on the day of her wedding, Arianna is forced to take her place to save her family from ruin. But her new husband is angry, heartbroken, and seems to hate her guts. The cold, elusive billionaire Zach Price has never quite struck Arianna as the kind of man she'd want to spend her entire life with. She was more than content with her sweet, thoughtful boyfriend Noah, but when circumstances force them together, Zach and Arianna's hearts get entangled in a way she never saw coming. As the couple grows closer, they must battle the demons of their past and of the lives they left behind - especially when Olivia returns and decides she wants Zach all for herself. Content/Trigger Warning: This story contains scenes of violence and sexual abuse, and mentions abortion and miscarriage. [[word count: 100,000-150,000 words]] Cover designed by Ren Tachibana
𝕄𝕪 𝕃𝕠𝕧𝕖 ( Completed ) ✔️ by Aashi055
53 parts Complete
" ඔයා මට රිද්දනවා සිතෙව්...." " අඩපන් තව අඩපන්...මගේ මල්ලිට කරපු දේට උබ විදවන්න ඕනේ..." " ඔයා ඉන්නේ වැරදි වැටහීමක...." " උබට රිදෙන රිදෙන වාරයක් ගානේ මට සතුටුයි..." " කවදාහරි ඇත්ත දැනගත්ත දවසක ඔයාට පසුතැවෙන්න වෙයි..." . . . . . . . . " එදා උබව තේරුම් නොගත්තට මට සමාවෙයන් මැණික...පුළුවන්නම් ආයෙත් මං ලගට වරෙන්...මට උබ නැතුව ඉන්න බෑ රත්තරන්..." සිතෙව් ❤️ විහස්
The Alpha King's Mate by Bookdragon2022
32 parts Complete
"Y-your H-highness? I-i'm sorry b-but t-there m-must b-be a-a m-mistake..." A loud growl sounded through the whole ballroom causing me to start shaking and a whimper to escape my lips. This caused the King to stop growling. He pulled me to his chest and yelled out to the whole ballroom. "MINE!" Audrey is an Omega in the Rapid River Pack. Lucas is the Alpha King, Ruling over all and his own pack, The Moonlight Eclipse Pack. Audrey is beaten daily loosing all hope of every meeting her mate. Lucas just wants his mate but feels like she doesn't exist. What happens when the two meet at the Annual Lunar Eclipse Ball? Credits to @M_Rainberry for the amazingly wonderful cover!!!
A-ဧ (Complete) by BreezeNway
65 parts Complete
အထက်တန်းမှာ ကြိုက်ခဲ့တဲ့အချစ်ဦးလေးနဲ့ 3နှစ်ကြာပြီးနောက် ပြန်တွေ့သောအခါ...
The Girl He Never Noticed by sweetdreamer33
92 parts Complete
When billionaire bad boy Eros meets shy, nerdy Jade, he doesn't recognize her from his past. Will they be able to look past their secrets and fall in love again? ****** When Jade Collins goes to work for billionaire bad boy Eros Petrakis, all she thinks she'll be doing is making his coffee...but when sparks fly, the shy Jade (who wears a disguise to mask her beauty and the secrets of her past) and the fiery, cocky Eros (who is solely focused on business and doesn't believe in the distractions of love) begin to grow closer and closer. Will Eros be able to see past her disguise to the beauty within? And will Jade be able to tame his heart -- and her own -- once the man of her dreams finally notices her? ****** Officially now a series! Watch it for free on MediaCorp's Youtube Channel- MediaCorp Drama. [[Word Count: 150,000 - 200,000]] The Girl He Never Noticed (Book 1 + 2) by Neilani Alejandrino (Sweetdreamer33) Copyright © 2015. All Rights Reserved.
Babysitting The Bad Boy by exxxyR
39 parts Complete
{#1 in teenagers} {#2 in fiction} {#2 in popular} "You better not tell anyone about this." "Aw why not? I'm sure your fandom of desperate girls would love to know that their precious prince charming needs a babysitter." I smile innocently back at his death glare. "I'm serious, nerd. I could make your life hell." ------------------------------------------------------------ Marnie Jones is an ordinary 11th grader. Her only intentions are to get good grades and save money for college with her babysitting job. Everything is going to plan. Until she gets a job babysitting the high school bad boy, Zeke Blakely. The two come from complete different social groups, and Marnie automatically hates Zeke and his big ego and cocky attitude. He's a player. He's dangerous. He's reckless. She's safe with an overthinking problem. As the two are seen hanging around school together, attention gets drawn to Marnie. Which she hates. But she also catches the eye of a handsome jock, too. And why, you ask, does a 17 year old boy need a babysitter? You'll have to read to find out. WARNING: contains vulgar language and mature scenes.
Anshi-Ek cheekh by savageblinkaish
33 parts Ongoing
this story is not for everyone
You may also like
Slide 1 of 20
💞THE GUILTY HEARTS .💞The Fault In Our Stars 💖 cover
The Prodigy | ✔︎ cover
𝐇𝐈𝐒 𝐑𝐈𝐕𝐀𝐋, 𝐇𝐈𝐒 𝐑𝐔𝐈𝐍┃ᵗᵃᵉᵏᵒᵒᵏ cover
MISTRESS OF FLAME cover
လူဆိုးလေး cover
The Cop Next Door cover
Une nuit à la cité cover
Baby to me cover
The Beast cover
Ex-Husband Turned Boss (Original Version) cover
𝐀𝐬𝐡𝐞𝐬 & 𝐢𝐧𝐤𝐬 cover
His Possession In Discretion | ✓ - DISCRETION SERIES BOOK #1 cover
Secret & Scars cover
I Was Never Yours cover
𝕄𝕪 𝕃𝕠𝕧𝕖 ( Completed ) ✔️ cover
The Alpha King's Mate cover
A-ဧ (Complete) cover
The Girl He Never Noticed cover
Babysitting The Bad Boy cover
Anshi-Ek cheekh cover

💞THE GUILTY HEARTS .💞The Fault In Our Stars 💖

78 parts Ongoing

This Is A Different Story. Book 1 completed.and Now Book 2 is going to be starting. 1). what if jayjay's father JASPHER MARIANO was the one here about the section e's plan when that time? 2). what if jeana Fernandez and jaspher mariano remarried? 3). what if after keifers return jay suddenly disappeared from HVIS and PHILIPIAN 4). After one month keifer and section e saw jay in a Halloween party with a man who was kissing her cheek .and she called him her own boyfriend 5). what if keifer turns a beast watson in that party 6). what if keifer try to do something wrong to jay 7). is this girl is our section e's mutya ? their doubt if she is not jay who was that girl ? is she related to jay . 8). after one month jays back to HVIS .but why section e is not chasing her ignoring her . why suddenly keifer started to hate her . didn't follow her

More details