Story cover for Specter v Ross by wykdkity
Specter v Ross
wykdkity
  • WpView
    Reads 16
  • WpVote
    Votes 0
  • WpPart
    Parts 1
  • WpHistory
    Time 3h 2m
  • WpView
    Reads 16
  • WpVote
    Votes 0
  • WpPart
    Parts 1
  • WpHistory
    Time 3h 2m
wykdkity
Ongoing, First published Nov 05, 2025
Mature
abusiveboyfriendemotionalblackmailfanficharveysharveysepcterlawyermalexmalemikerosssuits
Mike and Harvey was clearly a match made in Heaven, they move like they've known each other for ages, their attraction was obvious despite them pretending not to notice now if they could just get past the work politics and the annoying exes.
All Rights Reserved
abusiveboyfriendemotionalblackmailfanficharveysharveysepcterlawyermalexmalemikerosssuits
Table of contents

1 part

Sign up to add Specter v Ross to your library and receive updates
or
Content Guidelines
You may also like
Surviving High School. 👈👈😎 by Hstowe
29 parts Complete Mature
Our parent's made life look easy. They made love look easy. What they didnt make look easy? Was High School. They didn't tell us High School could tear friends apart. Or that people would get treated like complete trash. Adults talk about how kids will face the real world after High School. Pft. Try facing the real world in High School. Where nothing makes sense. And when someone tells you, they love you. Feels like a lie. [BOOK TWO OF: Enter If You Dare.]
Lottery // Harvey Specter by Stories_of_sonder
22 parts Complete
"You used to tell me that: love is lottery, but you got your numbers and you're betting on me. Are you still betting on me?" ~~~*~~~ Harvey Specter and Kyra Anderson were epic. He left, she stayed behind. Now he is broken, while she is breaking. It's been fifteen years. Are you still betting on me? [#3 in #suits] Suits fanfic (S6) It's perfectly able to be read if you haven't seen Suits, it's just a tragic love story in the world of lawyers and courtrooms. (Disclaimer: all rights belong to the makers of Suits and Me Before You)
Bad timing by poppysmicswonder
13 parts Complete Mature
This story takes place right after Donna tells Harvey that she's leaving him to go work for Louis. Harvey is in therapy. Though all he wants from his doctor is more sleeping pills so he can stop having anxiety dreams about missing important meetings. Which is also happening in real life because he has not replaced Donna since she left to work for Louis, nor can he apparently manage basic administrative tasks like keeping an appointment calendar or checking his phone messages. Harvey forgot about meeting that afternoon. It's a new employer. Senior partner - Blake Harlow. I used a storyline from the show Suits at first and later picked up some scenes, as needed. The rest is my own imagination. (Disclaimer: all rights of the characters belong to the makers of Suits, I have one female original character at the beginning of this story and one male original character as it goes further.)
A Preschool Promise [A Bensler FanFic] by GirlandHerKeyboard
53 parts Complete Mature
Before they were old enough to know what love truly was, Olivia and Elliot had fallen in love. From preschool to adulthood, Olivia and Elliot couldn't get each other off of their minds. Elliot got married and had a daughter, while Olivia dated but never found someone as important to her as Elliot was. When they met again as adults and as partners, they decided to keep the promise Elliot and Olivia had talked about in preschool. Once they were older, they were going to get married. Cover Made By: Elliot_Sebastian_
The Laws Of Attraction by ShadowButterfly_786
25 parts Complete
Their parents-lifelong best friends-have ensured they've known each other since childhood. Now, as top students in their law school, they are rivals in everything: grades, moot court competitions, and even their shared internship application at a prestigious law firm.
Rewritten ° Harvey Specter ✓ by -ScarsPetrova
40 parts Complete Mature
{HIGHEST RANKING #1 SPECTER} THIS BOOK CONTAINS SPOILERS TO THE SHOW! ❝you can't control who you care for.❞ a tale of two lawyers who work together but struggle to express their thoughts of each other. [completed, unedited (sequel: stalemate) ✓ cover by @remuslupout] [DISCLAIMER: ALL RIGHTS FOR GIFS AND PICTURES GOES TO THE ORIGINAL CREATORS! AS WELL AS THE ACTORS THEMSELVES. These were all found on the public domain! I only own the story itself!]
Dream {completed} by LuvChrissy
47 parts Complete Mature
They are from such different worlds seen things through different eyes and yet couldn't fit together anymore perfect *title changed from Strip same story same characters*
Loved until the end (SHS Series 02) by TPh_Cat
24 parts Complete
COMPLETE/UNEDITED!! Ever since they were kids, they're parents already engaged them. They always fought when they were young not until they see each other after many years that they are apart. Will they still like each other? Or will they just continue the quarrels between the two when they were young.
Fire meet gasoline (Skeet Ulrich) by Ana_Sassy
35 parts Complete Mature
I knew I shouldn't do it. There were million reasons not to, but one was above them. The strongest one. Love. I was looking at him and my heartbeat got slower. I was in total peace, standing there and looking at the most special person, this beautiful man who showed me, what it means to love. I forgot about everything out there when he smiled and reached for me. "You are so beautiful, my love," he whispered and tangled his fingers with my hair. "Three metres above the sky," I whispered, "you remember that one?" He nodded. "I think we're more across the universe," I kissed him where his heart is.
80s imagines ▸ gif series ✓ by outsidersxobsessed
123 parts Complete Mature
Basically what the title says!
You may also like
Slide 1 of 10
Surviving High School. 👈👈😎 cover
Lottery // Harvey Specter cover
Bad timing cover
A Preschool Promise [A Bensler FanFic] cover
The Laws Of Attraction cover
Rewritten ° Harvey Specter ✓ cover
Dream {completed} cover
Loved until the end (SHS Series 02) cover
Fire meet gasoline (Skeet Ulrich) cover
80s imagines ▸ gif series ✓ cover

Surviving High School. 👈👈😎

29 parts Complete Mature

Our parent's made life look easy. They made love look easy. What they didnt make look easy? Was High School. They didn't tell us High School could tear friends apart. Or that people would get treated like complete trash. Adults talk about how kids will face the real world after High School. Pft. Try facing the real world in High School. Where nothing makes sense. And when someone tells you, they love you. Feels like a lie. [BOOK TWO OF: Enter If You Dare.]

More details