The Dark Legend; Lucifer
Alisa-S
  • Reads 382
  • Votes 4
  • Parts 2
  • Time <5 mins
  • Reads 382
  • Votes 4
  • Parts 2
  • Time <5 mins
Alisa-S
Ongoing, First published May 24, 2015
adambibledarkevagodlegendlilithlucifermythpegansatansatenvampire
In Bible, the first woman on earth named Eva, while in pagan mythology was Lilith but her name was deleted.
	Lilith loved Lucifer all her heart. Adam was in anguish when lost his soul mate to Lucifer who didn’t know even true love.
	Finally Lilith knew the truth that Lucifer was a liar. She was abandoned like she was meaningless for him.
	Lilith was nothing for Lucifer because he already had destroyed God’s plan. He thought that everything was his belonging even Lilith, although all of that was Adam’s authority.

When I love, I love all my heart
When I hate… My hate like poison
I was driven by love and hatred

Watch The Dark Legend; Lucifer / Alisa S. (Trailer) on Youtube 
https://www.youtube.com/watch?v=bdUzIVs5BPo
or search on You tube ; Lucifer Alisa(it easy to found)
Public Domain
adambibledarkevagodlegendlilithlucifermythpegansatansatenvampire
Table of contents

2 parts

Sign up to add The Dark Legend; Lucifer to your library and receive updates
or
#5pegan
Content Guidelines
You may also like
THE DANCING GIRL by kakpie291203
27 parts Complete
Noor, a dancer in the Royal Court of the Al-Yauzhan Empire wants nothing more than to pay off her debts and lead a nice, simple life-but a chance encounter with the crown prince and his brother brings her into the dangerous world of court politics. As Noor and the princes investigate their uncle and cousin's possible treason, she grows closer to the crown prince, but in order to save the kingdom and the person she loves, Noor will have to risk everything... A romantic adventure set in an imagined Arabic kingdom, THE DANCING GIRL is a story of court intrigues, romantic entanglements, and secret meetings as Noor and her best friend Amir try to help the princes they're falling for expose corrupt court officials with plans to seize the throne. Noor and Amir are close to having everything they've ever dreamed of...now all they need to do is survive.
You may also like
Slide 1 of 1
THE DANCING GIRL cover

THE DANCING GIRL

27 parts Complete

Noor, a dancer in the Royal Court of the Al-Yauzhan Empire wants nothing more than to pay off her debts and lead a nice, simple life-but a chance encounter with the crown prince and his brother brings her into the dangerous world of court politics. As Noor and the princes investigate their uncle and cousin's possible treason, she grows closer to the crown prince, but in order to save the kingdom and the person she loves, Noor will have to risk everything... A romantic adventure set in an imagined Arabic kingdom, THE DANCING GIRL is a story of court intrigues, romantic entanglements, and secret meetings as Noor and her best friend Amir try to help the princes they're falling for expose corrupt court officials with plans to seize the throne. Noor and Amir are close to having everything they've ever dreamed of...now all they need to do is survive.

More details