The Dark Legend; Lucifer
Alisa-S
  • Reads 382
  • Votes 4
  • Parts 2
  • Time <5 mins
  • Reads 382
  • Votes 4
  • Parts 2
  • Time <5 mins
Alisa-S
Ongoing, First published May 24, 2015
adambibledarkevagodlegendlilithlucifermythpegansatansatenvampire
In Bible, the first woman on earth named Eva, while in pagan mythology was Lilith but her name was deleted.
	Lilith loved Lucifer all her heart. Adam was in anguish when lost his soul mate to Lucifer who didn’t know even true love.
	Finally Lilith knew the truth that Lucifer was a liar. She was abandoned like she was meaningless for him.
	Lilith was nothing for Lucifer because he already had destroyed God’s plan. He thought that everything was his belonging even Lilith, although all of that was Adam’s authority.

When I love, I love all my heart
When I hate… My hate like poison
I was driven by love and hatred

Watch The Dark Legend; Lucifer / Alisa S. (Trailer) on Youtube 
https://www.youtube.com/watch?v=bdUzIVs5BPo
or search on You tube ; Lucifer Alisa(it easy to found)
Public Domain
adambibledarkevagodlegendlilithlucifermythpegansatansatenvampire
Table of contents

2 parts

Sign up to add The Dark Legend; Lucifer to your library and receive updates
or
#7pegan
Content Guidelines
You may also like
A Song of Gelato and Flambé by BksbyBkr
33 parts Complete
In the epic conclusion to the Devil's Deal series, Freya has one final chance to discover the full potential of her own power, and to use it to restore balance in the universe - once and for all. After the destruction caused by Roisin, Ferya and Torix come to terms with their losses and mistakes... And prepare for a final battle that will change everything.
You may also like
Slide 1 of 1
A Song of Gelato and Flambé cover

A Song of Gelato and Flambé

33 parts Complete

In the epic conclusion to the Devil's Deal series, Freya has one final chance to discover the full potential of her own power, and to use it to restore balance in the universe - once and for all. After the destruction caused by Roisin, Ferya and Torix come to terms with their losses and mistakes... And prepare for a final battle that will change everything.

More details