WHITEHART
Thegirlwithharley
  • Reads 1,998
  • Votes 88
  • Parts 10
  • Time 1h 28m
  • Reads 1,998
  • Votes 88
  • Parts 10
  • Time 1h 28m
Thegirlwithharley
Ongoing, First published Jul 01, 2015
Mature
badbikesbrooklyncarsdanieldarkdramafamilyfantasyfriendsgirlliveslovepartiesrachelromancetroublewattys2015
Rachel is a beautiful girl. She's smart,from one of the private schools of Brooklyn. Even though she looks like those rich girls you see walking around the city in squads having nothing to do with the streets, but she's nothing like that. Even though she pretends to know nothing but she's known to everything. From those mobsters hiding in downtown to the Mayor because she's always been a trouble maker and a fake personality.

Who she doesn't know is Daniel Blake, the guy from her school who has suddenly started hanging out with her group. The guy who looks downright innocent but evil. The type of guy who sits on the last seat in the class with his boy gang .The guy girls usually stares in the lunch time or near the parking lot. But Rachel is too busy getting her life in control. 

Rachel fits in the imaginary scenario of being another normal high school girl but she has secrets. Dark ones, self destructive secrets that no one knows.
Daniel on the other hand knows she's not  what she shows and he is stubborn on knowing her dark sides only not knowing that he has already fallen for her. 

Naive and stupid, way apart from each other and living in their old world, How did they even find each other?

Will Rachel accept him?
Can Daniel accept her secrets?
Would they fit in each other's lives?

We always read and listen to those stories where the bad boy and the good girl falls in love with each other and end up together but this is nothing like that. This story has nothing to do with that thing. It is a story where two people who are unknown to their own feelings fall in trouble together and the trouble is Love.
All Rights Reserved
badbikesbrooklyncarsdanieldarkdramafamilyfantasyfriendsgirlliveslovepartiesrachelromancetroublewattys2015
Table of contents

10 parts

Sign up to add WHITEHART to your library and receive updates
or
Content Guidelines
You may also like
His Baby by AlexandriaRoseWalker
35 parts Complete Mature
A/N - There are many spelling and grammar mistakes - I apologise, also this was written when I was a teen so this story is so beyond reality. Thanks. Rose Quinten is the daughter of an ex-Navy seal turned security for the rich and famous. After a tragic life in England they up and move to sunny California where she meets the bad boy at a party when a guy tried to force himself on her he saves her, keeping her safe in a room they play games all night then things get heated. Rose unknowingly meets the family of the guy she slept with. Rose is in for one hell of an adventure and also gets more than she bargained for in the end. Comments - "I have to say this is a sweet romance that brings the wonders of being a new mom (dad) in to it, Its a romance that id read again (I've already read it a couple of times XD) I love how she (rose) is not like everyone else I've read. Its refreshing, I mean she's strong, hard-headed (at times) And witty. Its funny reading about how she boss's everyone around (in a good way of course) the Adventures. The tell of a girl turning in to the women she is to day. Its breath taking, I'm gonna stop now before I say to much, But its a good book that can make you laugh just as fast as it can make you cry.... Ok for real I'm stopping (lol) But its a wonderful read" - arrow1616 #5 in Teen Fiction out of 243k Stories - 03 Oct 2020 #3 in Teen Fiction out of 254k Stories - 25 Apr 2022 © This book is of my own creation and I reserve all rights to it. Pictures used in this book are Public Domain.
My Vampire Girlfriend by Spicym0th
22 parts Complete Mature
Fair warning I was really young when I wrote this also ⚠️THIS BOOK HAS LOTS OF TYPEOS IN MISTAKES READ AT YOUR OWN RISK ⚠️ ~Zoey is the neighborhoods good girl she's loved by many hated by some she's never really been interested in anybody until Jordan the new girl who just moved in next door. But Things took an unexpected turn when Zoey found something weird about the girl next door will Jordan push her away to protect her secrets or will Zoey find out about them. ~ ~This story is Fiction nothing or anyone in this story is real this story contains things like curse words, sex, Violence, and more i am not responsible for anything you do should you attempt anything from this story~ Ps this vampire story is going to be kind of chill I probably won't add no drama like that yes Jordan and her twin brother are vampires but they might or might not have that blood lust problem idk y'all just read it I'll figure it out but what I do know is that this story will mainly be about Zoey and Jordan's relationship
me, the gang leader✔ (Book 1) by just_me_mnm
27 parts Complete Mature
Hey. I'm just your average girl. I got it all. Family, friends and a social life. I like going outside seeking danger and adventure around every corner. A student in my class and mostly likely to succeed. Did I mention I'm also a gang leader. Oh, it must have slipped my mind. Zoë. Now the leader of a gang passed down to her. From being on the streets to being the number one gang in the city. She faces testing trials including self-healing, self-discovery, betrayal, love and vengeance. After being nocked down to being the second best gang she sets out on a mission to be the ultimate best by enrolling to the school her rival gangleader goes to. All seems to be going right until alternations, death and secrets come into play.she finds out a devastating secret. One that changes her life and her outlook on it. Best Rating- #3 in backstabers #9 in funny #10 in girlgangleader Disclaimer- I do not encourage any gang violence. This book is purely the work of fiction and should not be copied in real life. Book 1 in series of 'me, the gang leader' Need to read first. Sorry not so good at these type of stuff. Just read the book.😊 promise its good.
The School Player vs ME [DISCONTINUED] by LittleMissCrazy96
53 parts Complete
**It takes me a second to realize what is happening. Zac is kissing me! He is bloody kissing me!! Something then flashes and I realize Zac just took a picture of us. I push him away and back out of the car. How dare he kisses me and how dare he takes a picture! "WHAT THE HELL DO YOU THINK YOUR DOING?!!?" I yell at him. He shrugs and hops out the car like this was all a joke. Of course he think its a joke. He is Zac, the most annoying ass hole in the whole universe! "I need to add this to my collection." he says, showing me the picture he just took. I stare at the picture, anger building up inside me. He is so dead!** Katie Stone is your typical good girl and much to her dismay, she just so happens to live with the school player. She hates her life. She really, really hates it. And it's all because of one person: Zac Hansan. Zac is your typical high school heartthrob, who is always flashing his bad boy smile and stealing hearts. Zac loves his life, but not as much as he loves tormenting Katie. But much to Zac's dismay, his insanely good looks and bad boy attitude don't have the slightest effect on Katie. So what happens when these two are connected and dragged into the dark and messy past of their families? It is when this dark secret is revealed that both Katie and Zac are forced to put their differences aside and work together. Their actions will ultimately save their own lives, and they will be forced to make choices they never thought they would have to make. Can two people who hate each other change from being enemies to friends? Or possibly even more? ✕Important Notice: I WILL BE DOING MAJOR EDITING VERY, VERY SOON! KEEP IN MIND THAT THERE WILL BE A LOT OF SPELLING AND GRAMMAR MISTAKES! JUST A HEADS UP! 🎥Story Trailer: http://www.youtube.com/watch?v=zfGef2CyjCo
The street-fighting nerd by raven_strom
35 parts Complete Mature
Meet Raven Night. She's 17. At school, she gets bullied because she's a "nerd". No one knows her past and she tends to keep it that way. During the day she is the nerd of the school. But at night she is the infamous street-fighter and racer, "Diablo". When she's not fighting or racing, she is the assassin "Death". Here's a little bit of her past, when she was 7 she watched her family get murdered in front of her. After that, she was sent to foster home after foster home. She was adopted by a man when she was 13. He is part of the second-most dangerous gang in the world. He hurts her for fun but she's afraid to try and stop him. Now meet Jacob William. He's 18. He and his other two friends just moved to town. When Jacob and his two friends(Michael & Caden) first arrived at Rosewood high, Raven was away on a mission. Jacob is a gang leader while Michael is his third-in-command and Caden is his second-in-command. Jacob had a dark past so he's cold to anyone that's not friends or family. Will Jacob and Raven open up to each other or will they hate each other? Find out in The street-fighting nerd. ⚠️⚠️This story has mature language and scenes. There will be murder and gore in this book. I will have LGBTQ+ people in this book. If you do not like this, DO NOT READ IT.⚠️⚠️ You have been warned.
Good Girl Gone Bad (Editing) | #Wattys2018 by RaeyaunaT
37 parts Complete Mature
Brooklynn Davis is a preacher kid. Her parents have high expectations for her. Her father is the pastor at Saint Rosemary Church. She lives in a small town, where the population is 185 people. Everyone knows everyone. The high school she goes to is the worst. She held up this good girl reputation all her life. She gets good grades, goes to church every Sunday, helps out with the homeless, tutors the elementary kids. She never did drugs of any kind, drink or go to wild parties. Her good life soon comes to an end when a new boy moves in across the street. He has a bad boy reputation. Criminal records, gangs, drug dealing and all that, he's done it all. And when he meets Brooklynn, she's not interested in him at first until he has to do some volunteer work at the church. They start to hang out and then he introduces some things to her. She will be turned into a bad girl messing with him. As she starts to be around him more, secrets starts to unravel. Big moves starts to happen. New people come into the picture.
ℂ𝕒𝕦𝕘𝕙𝕥 𝕚𝕟 𝕥𝕙𝕖 ℕ𝕖𝕠𝕟 𝔾𝕝𝕠𝕨 ➃ by AndiBlackbird
64 parts Complete Mature
✬ 𝕋𝕙𝕖 𝔻𝕒𝕣𝕜 ＆ 𝕃𝕚𝕘𝕙𝕥 𝕊𝕖𝕣𝕚𝕖𝕤 ✬ There is a crucial moment in one's life that determines the outcome of everything; well, as books and movies would have you believe. But Monica McCaslin didn't think she would ever be one of those people, would ever have one of those moments. Brought up in a small suburb, with everything she could ever ask for, there wasn't much left for her to want. Monica's ordinary life was to go as such- follow her high school sweetheart to college, graduate, get married, have two kids; the cookie cutter life. White picket fence included. What she did not expect was to meet a dark-haired stranger sitting all alone on a park bench, at that very same school she was to attend with said future husband. After a brief conversation, just a handful of words between them, Monica decides to go on a cross-country road trip with him; putting her faith and future in the hands of a stranger. Thinking she'd soon regret her decision and the life she left behind, she realizes she doesn't at all. Free of expectation and a future that she thought was set in stone, she begins to find the woman she was truly meant to be. State by state, with each border they cross, Monica liberates her true self. 𝔹𝕠𝕠𝕜 ➃ 𝕠𝕗 ➃ - ℂ𝕠𝕞𝕡𝕝𝕖𝕥𝕖 - ✬ ✫ ✬ ✫ ✬ ✫ ✬ ✫ ✬ ✫ ✬ ✫ ✬ ✫ ✬ ✫ ✬ ✫ ✬ This is a work of fiction. This all comes from inside of my mind. If there are any similarities to people, places, events, etc. they are purely coincidental. Also, this book has mature themes such as explicit language, sexual content, and violence. It is intended for MATURE audiences only. ©2021 | AndiBlackbird Started: 1-15-21 Completed: 5-9-21
Falling For Noah Miller by cloudysunburn
38 parts Complete
-Completed- Why does a story have to be about a bad boy and good girl? Why does the guy always have to be bad? Why can't the story be about the good guy and the good girl? Skylar Greene isn't someone you would consider popular. In her free time she would rather spend her time in her room reading a Nicholas Sparks book, sleeping, watch re-runs of old tv shows, listening to Ed Sheeran or fangirling over superheros. She is awkward, lacking social skills, and is shy at times but rambles when she's nervous. She is so clumsy she is literally falling through life. Noah Miller is someone you would definitely consider popular. He has the looks and is the best football player on the schools team. He isn't your typical popular guy who is rude to people who aren't popular. He is actually extremely nice to everyone which is why everyone loves him. He loves meeting knew people and having fun. When Skylar and Noah meet in the nurses office one day, everything changes. Noah takes interest in her and drags the socially awkward girl to parties, football games, and even gets them in trouble with the cops. But he's only trying to show her a good time. Soon enough Skylar finds herself falling for this guy. They start telling each other things they never told anyone before. Skylar actually thinks he likes her back and it can work out. But when series of unfortunate events happen everything changes and Skylar doesn't know how anything will turn out. Is falling for Noah Miller something she will end up regretting or something that will all be worth it in the end?
In the arms of evil by michaela_16_xo
36 parts Complete Mature
Brooklyn Peterson, an twenty-one year old girl, leaves her home town in hopes of escaping an abusive past lover. But when she meets Colton Anderson in a run down bar, he can't take his eyes off her. He's cocky and handsome and will kill those who wish to do her harm. He's found something pure that he wants and he won't stop until he gets her. He's got his own demons that want to destroy him. When they find out about her, he has to choose between saving her or himself. He brings out a darker side to Brooklyn. One she didn't know she had. It's good girl gone bad for the guy she loves, and the problem? She likes danger just as much as he does. Especially the way it tastes on his lips. Colton holds a dark secret buried in his heart. And if Brooklyn was to ever find out, he risks driving her away for good. Does he have the strength to keep their love alive? Will their dark secrets come back and destroy them both? Or will one sacrifice themselves for the other ? How powerful can true love truly be? DISCLAIMER: This story is for mature audiences and deals with abuse as well as sexual chapters. Do not read if you are under 18!
Torn Between Two Lovers & The Streets by FredericaThompson
34 parts Complete Mature
Maya finds herself battling between two lovers and the streets. Maya has always been that chick who rode out for her friends. She always made a way out of no way when it came to making money. She ran into one particular individual that made her change some of her ways. But then she ran into another one who made her realize that it's more to life than just the street's. Maya finds herself battling between two individuals that want to love her and take her off the streets. But if Maya is ready to give up the streets will she settle with one of the individuals? And is it worth it or not. Will maya find love in one of the two or will she fall victim to the streets. Is love everlasting or is it just unreal to have. Maya will have to start making plans for her future if she wants to change. But when it comes to Maya she's going to make everything one hell of a ride baby. Will Maya be that baby or will Maya be for the streets.
You may also like
Slide 1 of 10
His Baby cover
My Vampire Girlfriend cover
me, the gang leader✔ (Book 1) cover
The School Player vs ME [DISCONTINUED] cover
The street-fighting nerd cover
Good Girl Gone Bad (Editing) | #Wattys2018 cover
ℂ𝕒𝕦𝕘𝕙𝕥 𝕚𝕟 𝕥𝕙𝕖 ℕ𝕖𝕠𝕟 𝔾𝕝𝕠𝕨 ➃ cover
Falling For Noah Miller cover
In the arms of evil cover
Torn Between Two Lovers & The Streets cover

His Baby

35 parts Complete Mature

A/N - There are many spelling and grammar mistakes - I apologise, also this was written when I was a teen so this story is so beyond reality. Thanks. Rose Quinten is the daughter of an ex-Navy seal turned security for the rich and famous. After a tragic life in England they up and move to sunny California where she meets the bad boy at a party when a guy tried to force himself on her he saves her, keeping her safe in a room they play games all night then things get heated. Rose unknowingly meets the family of the guy she slept with. Rose is in for one hell of an adventure and also gets more than she bargained for in the end. Comments - "I have to say this is a sweet romance that brings the wonders of being a new mom (dad) in to it, Its a romance that id read again (I've already read it a couple of times XD) I love how she (rose) is not like everyone else I've read. Its refreshing, I mean she's strong, hard-headed (at times) And witty. Its funny reading about how she boss's everyone around (in a good way of course) the Adventures. The tell of a girl turning in to the women she is to day. Its breath taking, I'm gonna stop now before I say to much, But its a good book that can make you laugh just as fast as it can make you cry.... Ok for real I'm stopping (lol) But its a wonderful read" - arrow1616 #5 in Teen Fiction out of 243k Stories - 03 Oct 2020 #3 in Teen Fiction out of 254k Stories - 25 Apr 2022 © This book is of my own creation and I reserve all rights to it. Pictures used in this book are Public Domain.

More details