Tips to maintain your health at 40's
drsumakrupashankar
  • Reads 10
  • Votes 0
  • Parts 1
  • Time <5 mins
  • Reads 10
  • Votes 0
  • Parts 1
  • Time <5 mins
drsumakrupashankar
Ongoing, First published Jul 27, 2015
drsumakrupashankardrsumakrupashankardermatologistdrsumakrupashankarreviewshealthcarelifestyle
When we enter the age of 40, it turns into a leap forward as the risk of various health issues gets expanded. This makes this age a faultless time for taking heap of your health. Whether people have exceptionally busy professional life, obligations of kids, or most of the over, it's definitely not hard to set your health aside. 
Nowadays the foods we take are exposed to harmful toxins and have less nutritional value. Even we find ourselves less active than we once were. These all are the side effects of living a poor and unhealthy lifestyle which we must change immediately.
Amid this decade of your life you should attempt more endeavors to turn aside your health issues like diabetes, blood pressure and heart problems. The accompanying tips from Dr. Suma Krupa Shankar can help you to rediscover a healthy life:
•Exercise regularly: Doing exercises will reduce your stress and will help you in maintaining a healthy lifestyle. It will also reduce the risk for diabetes, heart disease etc.
•Healthy eating habit- Our metabolism slows down when we enter the age of 40, but by adopting healthy eating habits can support our health. You must take nutritional foods. Taking protein rich diet, fruits, vegetables, low-fat dairy products and whole grains will be beneficial.
•Take sufficient sleep- Taking 7 to 8 hours of sleep of good quality is considered very healthy. Loss of sleep can cause several health issues.
•Cut down bad habits- If you're a smoker or addicted to alcohol then it is the time to take this seriously to stop smoking and drinking alcohol.
Follow these tips to ensure a healthy life for yourself.
All Rights Reserved
drsumakrupashankardrsumakrupashankardermatologistdrsumakrupashankarreviewshealthcarelifestyle
Table of contents

1 part

Sign up to add Tips to maintain your health at 40's to your library and receive updates
or
Content Guidelines
You may also like
Wendizzy's Writer Room by Wendizzy
2 parts Ongoing
In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.
You may also like
Slide 1 of 1
Wendizzy's Writer Room cover

Wendizzy's Writer Room

2 parts Ongoing

In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.

More details