Blue Moon
kendellandbeau
  • Reads 9,290
  • Votes 451
  • Parts 12
  • Time 4h 1m
  • Reads 9,290
  • Votes 451
  • Parts 12
  • Time 4h 1m
kendellandbeau
Ongoing, First published Mar 25, 2013
comedysdramafanfanfictionfirstfriendsgirlgirlsjacoblovelovednewrenesmeesassytwilightvampirewolfs
It's been 7 years since the Volturi came for Renesmee Because of her existence of being half human half vampire. Jacob confesses his love towards Renesmee what if she dose not feel the same? what if Jacob finds his true mate after a broken heart left by Renesmee? What happens if Renesmee finds her true love in someone unexpected? Find out now and read Blue Moon a story of twist and turns.                                            

  Edited by Lovehymn a fantastic wattpader. I don't own the Twilight series, but to the amazing Stephanie Myers, these are my original ideas though. © All Rights Reserved. 2015
All Rights Reserved
comedysdramafanfanfictionfirstfriendsgirlgirlsjacoblovelovednewrenesmeesassytwilightvampirewolfs
Table of contents

12 parts

Sign up to add Blue Moon to your library and receive updates
or
Content Guidelines
You may also like
𝐓𝐡𝐞 𝐅𝐨𝐫𝐦𝐞𝐫 𝐂𝐮𝐥𝐥𝐞𝐧 (𝐒𝐀𝐋𝐕𝐀𝐓𝐎𝐑𝐄) by moonlightforks
43 parts Complete Mature
Renesmee had a twin that everyone loved. but she was more human and they had to give her up. Renesmee loved her sister- in fact she was very protective of her. They had no choice but to put her for adoption. It wasn't safe for her, she was more human and they wanted her to have a normal life. [crossover of tts and tvd- more of tvd] -------------------------- "Look at her" she smiles down at the baby in her arms. "She's so precious, she's mine- ours!" "Elena." I walk over to her, "who's baby is that? god please don't tell me you snatched it from someone. you know that poor baby has a family, right?" I raise my eyebrow at her. "No Damon! some of my coworkers were talking about how she was transfered to the hospital late last night. Her family left her for adoption" she pauses and gently strokes the baby's cheek, "so I couldn't help myself, and I saw her. Something about her just made me fall in love." She always wanted a baby. I couldn't give her that. "fine" She jumps up excitedly spinning the baby around.
Eternal Sunshine by RMBlythe
12 parts Complete
No one ever said life as a human/vampire hybrid would be easy. As Renesmee comes of age, there are many challenges she must face, and questions she needs answered. For instance, who are the new wolves that have arrived in Forks and what do they want? And why does her heart beat faster every time she's around Jacob Black? First in a series. Originally on ff.net. Updated from original posting. Complete.
Never Let Me Go (Renesmee & Jacob Twilight Fanfiction) 2020 by rachi16uk
69 parts Complete
STORY COMPLETE Two best friends, about to enter into the dating scene separately. Except the boy is a werewolf and the girl a vampire / human hybrid. Oh and he's been secretly, entirely bound to her heart and soul magically since she was born. I'm sure this will work out fine....surely? How will they deal with the changes in their lives, pressures of school and the pack? Especially when new Vampires come into town with a life changing agenda. A Jacob and Renesmee Twilight fanfiction. Started 3rd July 2019 This is my first fanfiction. I don't consider myself a writer, I just have stories in my head. So I appologize for horrific grammar! I wrote this story for myself, but recently decided to publish on here in the hope others might find enjoyment in it.
First Kiss of Passion by Allilyinlife
20 parts Complete Mature
Renesmee Cullen is conflicted about her feelings for Jacob Black, the hunky werewolf who's been her best friend since before she could remember. But now Renesmee is growing older, developing and feeling strange, unusual feelings towards Jake. Can they turn their friendship into love or will it tear them apart? (This is what I imagined the life of Jacob and Renesmee to be. It begins a few years after Breaking Dawn when Renesmee is about sixteen.) Rated mature for coarse language and sexual content. Has a slow start before the smut begins.
The Twilight Saga: Rising Sun (Fanfiction) by Miley_Mehak
23 parts Complete
A Fan fiction sequence to Breaking Dawn. Three years have passed after the Breaking Dawn 2 incident. Renesmee is three years old. She has a superb life, loving family and caring Jacob. She has started going to school. But one day, Renesmee's whole life changed, when a turning point entered her life. She is gifted with a new power. And new power brought new enemies. Enemies from an unknown past. But one thing is for sure, her new power will lead to dare consequences Now we have to see how Renesmee manages to tackle these consequences along with her typical teenage problems. P.S.:- Make sure to read "Summer Moon", it's sequel. Available on my wall. ~Forever Starts Here~
A Jacob and Renesmee Story: Everlasting Love by charlottetex2
45 parts Complete Mature
A sequel to A different side of Twilight Breaking dawn, after the entire vampire and werewolf feud with the Cullen family and the Volturi, Jacob, and Renesmee grew up, getting to know each other, protecting each other, and becoming best friends. As they grow older, their friendship gets stronger and closer than ever, but something happens. Jacob makes a colossal mistake breaking a massive promise to Bella and Edward, causing them to get angry and split Renesmee and Jacob apart by taking them out of town for a couple of years. Then when Bella and Renesmee come back for something from the family who stayed in Forks, Renesmee sneaks off with Jacob and runs away from her family. What will happen next? Will they find her, and will Edward and Bella forgive Jacob? But more importantly, where will their relationship go?
Destined- Twilight fan fic by DevinelyBookish
16 parts Complete
**Under Editing** After everything Renesmee has been through, she can finally relax and enjoy life. Now Sixteen, her life is now complete with all her family, Jacob included. But Renesmee cannot help but feel left out. Like an outsider, she is neither wholly human or wholly vampire. And she certainly isn't a werewolf. One simple event could change all of this. For good or bad, Renesmee realises that she has to make one of the most important decisions of her life. One that will help her discover who she really is. As she discovers more about herself and her identity, she also realises that her Jacob Black may not be her true sole mate.
Forbidden Fruit (Jacob and Renesmee) by weirdlysimple
42 parts Complete
Jacob has just found out that he stopped aging at the age of 17. Renesmee has started to grow feelings for Jacob. Edward doesn't accept their relationship. Read to find out what happen next. (p.s. this is going to be a long book so just stick around) yes I know that's sucky description but it's good! ~Kay (this story has many cringy writing errors, a fast plot all that bad first time writer errors in it. I will not be changing it though because it shows me how much i have grown as a person and writer. if you enjoy this book please continue to read it and enjoy it as much as i would love you to. BUT... if you would like to see other things i write that i am proud of also (and a whole lot better) check out my other books.) also i don't go by kay
Ness' Comet by housecatwriting
92 parts Complete
Renesmee never had a normal childhood. Or a childhood at all really. But now she's determined to understand what it's like to be normal. She steps into the real world, away from the vampires and werewolves, to experience what being human can mean. Well, there may be one exception... What happens after Twilight: Breaking Dawn
A Different Side of Twilight Breaking Dawn by charlottetex2
35 parts Complete
What if at the end of breaking dawn pt 1, Jacob didn't imprint on Renesmee, and he is still in love with Bella when she awakes. What will happen to their relationship? Will they stay friends, or will there be more? Also, will Jacob imprint on someone?
You may also like
Slide 1 of 10
𝐓𝐡𝐞 𝐅𝐨𝐫𝐦𝐞𝐫 𝐂𝐮𝐥𝐥𝐞𝐧 (𝐒𝐀𝐋𝐕𝐀𝐓𝐎𝐑𝐄) cover
Eternal Sunshine cover
Never Let Me Go (Renesmee & Jacob Twilight Fanfiction) 2020 cover
First Kiss of Passion cover
The Twilight Saga: Rising Sun (Fanfiction) cover
A Jacob and Renesmee Story: Everlasting Love cover
Destined- Twilight fan fic cover
Forbidden Fruit (Jacob and Renesmee) cover
Ness' Comet cover
A Different Side of Twilight Breaking Dawn cover

𝐓𝐡𝐞 𝐅𝐨𝐫𝐦𝐞𝐫 𝐂𝐮𝐥𝐥𝐞𝐧 (𝐒𝐀𝐋𝐕𝐀𝐓𝐎𝐑𝐄)

43 parts Complete Mature

Renesmee had a twin that everyone loved. but she was more human and they had to give her up. Renesmee loved her sister- in fact she was very protective of her. They had no choice but to put her for adoption. It wasn't safe for her, she was more human and they wanted her to have a normal life. [crossover of tts and tvd- more of tvd] -------------------------- "Look at her" she smiles down at the baby in her arms. "She's so precious, she's mine- ours!" "Elena." I walk over to her, "who's baby is that? god please don't tell me you snatched it from someone. you know that poor baby has a family, right?" I raise my eyebrow at her. "No Damon! some of my coworkers were talking about how she was transfered to the hospital late last night. Her family left her for adoption" she pauses and gently strokes the baby's cheek, "so I couldn't help myself, and I saw her. Something about her just made me fall in love." She always wanted a baby. I couldn't give her that. "fine" She jumps up excitedly spinning the baby around.

More details