Story cover for Blue Moon by kendellandbeau
Blue Moon
kendellandbeau
  • WpView
    LECTURAS 9,318
  • WpVote
    Votos 451
  • WpPart
    Partes 12
  • WpHistory
    Hora 4h 1m
  • WpView
    LECTURAS 9,318
  • WpVote
    Votos 451
  • WpPart
    Partes 12
  • WpHistory
    Hora 4h 1m
kendellandbeau
Continúa, Has publicado mar 25, 2013
comedysdramafanfanfictionfirstfriendsgirlgirlsjacoblovelovednewrenesmeesassytwilightvampirewolfs
It's been 7 years since the Volturi came for Renesmee Because of her existence of being half human half vampire. Jacob confesses his love towards Renesmee what if she dose not feel the same? what if Jacob finds his true mate after a broken heart left by Renesmee? What happens if Renesmee finds her true love in someone unexpected? Find out now and read Blue Moon a story of twist and turns.                                            

  Edited by Lovehymn a fantastic wattpader. I don't own the Twilight series, but to the amazing Stephanie Myers, these are my original ideas though. © All Rights Reserved. 2015
Todos los derechos reservados
comedysdramafanfanfictionfirstfriendsgirlgirlsjacoblovelovednewrenesmeesassytwilightvampirewolfs
Tabla de contenidos

12 partes

Regístrate para añadir Blue Moon a tu biblioteca y recibir actualizaciones
O
#343renesmee
Pautas de Contenido
Quizás también te guste
First Kiss of Passion de Allilyinlife
20 partes Concluida Contenido adulto
Renesmee Cullen is conflicted about her feelings for Jacob Black, the hunky werewolf who's been her best friend since before she could remember. But now Renesmee is growing older, developing and feeling strange, unusual feelings towards Jake. Can they turn their friendship into love or will it tear them apart? (This is what I imagined the life of Jacob and Renesmee to be. It begins a few years after Breaking Dawn when Renesmee is about sixteen.) Rated mature for coarse language and sexual content. Has a slow start before the smut begins.
A Jacob and Renesmee Story: Everlasting Love de charlottetex2
45 partes Concluida Contenido adulto
A sequel to A different side of Twilight Breaking dawn, after the entire vampire and werewolf feud with the Cullen family and the Volturi, Jacob, and Renesmee grew up, getting to know each other, protecting each other, and becoming best friends. As they grow older, their friendship gets stronger and closer than ever, but something happens. Jacob makes a colossal mistake breaking a massive promise to Bella and Edward, causing them to get angry and split Renesmee and Jacob apart by taking them out of town for a couple of years. Then when Bella and Renesmee come back for something from the family who stayed in Forks, Renesmee sneaks off with Jacob and runs away from her family. What will happen next? Will they find her, and will Edward and Bella forgive Jacob? But more importantly, where will their relationship go?
Ness' Comet de housecatwriting
92 partes Concluida
Renesmee never had a normal childhood. Or a childhood at all really. But now she's determined to understand what it's like to be normal. She steps into the real world, away from the vampires and werewolves, to experience what being human can mean. Well, there may be one exception... What happens after Twilight: Breaking Dawn
Destined- Twilight fan fic de DevinelyBookish
16 partes Concluida
**Under Editing** After everything Renesmee has been through, she can finally relax and enjoy life. Now Sixteen, her life is now complete with all her family, Jacob included. But Renesmee cannot help but feel left out. Like an outsider, she is neither wholly human or wholly vampire. And she certainly isn't a werewolf. One simple event could change all of this. For good or bad, Renesmee realises that she has to make one of the most important decisions of her life. One that will help her discover who she really is. As she discovers more about herself and her identity, she also realises that her Jacob Black may not be her true sole mate.
Crossbreed de dancercarmen
29 partes Concluida
This is a story following Jacob and Renesmee after the Twilight Saga, when Renesmee is of age. - - - I never knew my best friend would become the love of my life. It was all just a blur, it happened so fast. But in this moment, right here right now, I never felt this alive. - - - Disclaimer: My friend and I wrote this, but neither of us own any characters or ideas from Stephenie Meyer.
Our forever: twilight fan fiction de bellacullen19
20 partes Concluida
A new school year is approaching and the Cullen's are moving to live with their "cousins" the Denali coven. It's Bella's first year in high school as a vampire. She's scared she can't pull off the act of a human. She's also worrying about what she's going to tell her dad, Charlie, about the Cullen's moving to Alaska. Will Bella be able to hide that Renesme is her daughter? Will everyone be suspicious about the Cullen's like they were in Forks? Bella doesn't know if she can handle the realization of her new life. I do not own twilight. The characters belong to Stephanie Meyer. *COMPLETED*
Forbidden Fruit (Jacob and Renesmee) de weirdlysimple
42 partes Concluida Contenido adulto
Jacob has just found out that he stopped aging at the age of 17. Renesmee has started to grow feelings for Jacob. Edward doesn't accept their relationship. Read to find out what happen next. (p.s. this is going to be a long book so just stick around) yes I know that's sucky description but it's good! ~Kay (this story has many cringy writing errors, a fast plot all that bad first time writer errors in it. I will not be changing it though because it shows me how much i have grown as a person and writer. if you enjoy this book please continue to read it and enjoy it as much as i would love you to. BUT... if you would like to see other things i write that i am proud of also (and a whole lot better) check out my other books.) also i don't go by kay
Chances of Rain (A Jacob and Renesmee Love Story) de CheeseandVegemite
15 partes Continúa Contenido adulto
Some promises are never broken. Some bonds never fade. Years after the Cullen's vanish into Alaskan snow, Jacob Black lives quietly in La Push, his days filled with work, family and the effort to feel human again. But when the Volturi uncover the existence of a hybrid-child years later, the fragile calm of the world is shattered. Bella and Edward return to Forks - not for redemption but with a request that could change everything. they ask Jacob to protect the one thing that means the world to them: Renesmee Cullen. As ancient threats rise and hidden loyalties are tested, will peace ever be enough in the shadows of betrayal and war? In the quiet moments between danger and secrecy, an unexpected connection begins to grow - one that may shape the future of the human and supernatural world. Author note: I don't own anything. Some quotes from original books and movies.
The Twilight Saga: Rising Sun (Fanfiction) de Miley_Mehak
23 partes Concluida
A Fan fiction sequence to Breaking Dawn. Three years have passed after the Breaking Dawn 2 incident. Renesmee is three years old. She has a superb life, loving family and caring Jacob. She has started going to school. But one day, Renesmee's whole life changed, when a turning point entered her life. She is gifted with a new power. And new power brought new enemies. Enemies from an unknown past. But one thing is for sure, her new power will lead to dare consequences Now we have to see how Renesmee manages to tackle these consequences along with her typical teenage problems. P.S.:- Make sure to read "Summer Moon", it's sequel. Available on my wall. ~Forever Starts Here~
Jacob and Renesmee Happy Ever After ... de MoniqueLwandile
33 partes Concluida
in this fan Fiction everything goes wrong. It has been 4 years since the Volturi wanted to destroy Renesmee, and she has grow a lot. Renesmee's feelings change for Jacob on one morning. As she starts developing feeling for Jacob, there is a new Vampire in town, and he has set his eye on Renesmee. But he is not who he says he is. If you truly love someone you accept them, with all their falls and mistakes. Will Jacob accept Renesmee after what happened with Armando-the new vampire-? I hope you enjoy reading this. This is my own book, but the characters are not mine. except of the ones I make up.
Quizás también te guste
Slide 1 of 10
First Kiss of Passion cover
A Jacob and Renesmee Story: Everlasting Love cover
Ness' Comet cover
Destined- Twilight fan fic cover
Crossbreed cover
Our forever: twilight fan fiction cover
Forbidden Fruit (Jacob and Renesmee) cover
Chances of Rain (A Jacob and Renesmee Love Story) cover
The Twilight Saga: Rising Sun (Fanfiction) cover
Jacob and Renesmee Happy Ever After ... cover

First Kiss of Passion

20 partes Concluida Contenido adulto

Renesmee Cullen is conflicted about her feelings for Jacob Black, the hunky werewolf who's been her best friend since before she could remember. But now Renesmee is growing older, developing and feeling strange, unusual feelings towards Jake. Can they turn their friendship into love or will it tear them apart? (This is what I imagined the life of Jacob and Renesmee to be. It begins a few years after Breaking Dawn when Renesmee is about sixteen.) Rated mature for coarse language and sexual content. Has a slow start before the smut begins.

Más detalles