Story cover for So Wrong by Stellyyy
So Wrong
Stellyyy
  • WpView
    Reads 18
  • WpVote
    Votes 1
  • WpPart
    Parts 1
  • WpView
    Reads 18
  • WpVote
    Votes 1
  • WpPart
    Parts 1
Stellyyy
Ongoing, First published Sep 13, 2015
Mature
betrayalcheatingfvckedliesmalipagmamahalsowrongtemptationwrong
"Let me do this to you. Because you're JUST a bitch. A cheap one."
  
  A perfect happily ever after. Pero paano kung pumagitna ang distansya, kawalan ng komunikasyon.... You've been faithful for a long time.. Ngunit sa unang pagkakataon, lumiko ka... You did something SO BAD and you're still doing it while your partner isn't around... Pero nagsisi ka, nakonsensya.. Now, you want to end it all, end your mistakes. You were about to make it ALL RIGHT again.. but then.. You realized you've played so nonchalant.. so reckless. And what you used to call 'SO BAD' turned so worst.. SO WRONG.
  
  Betrayal. Temptation. Lies. LLOVE.
All Rights Reserved
betrayalcheatingfvckedliesmalipagmamahalsowrongtemptationwrong
Table of contents

1 part

Sign up to add So Wrong to your library and receive updates
or
Content Guidelines
You may also like
BERNARDO SERIES 1:ALICIA BERNARDO(COMPLETED) by akiratoya18
22 parts Complete
BERNARDO SERIES 1: ALICIA BERNARDO -" Mahal kita pero yung pagmamahal mo ang hindi ko maintindihan. Mali let me rephrase that mahal mo ba talaga ako o nangungulila ka lang sa kanya.? Naalala mo ba nung nagkasagutan tayo dahil don? Alam ko na sa sarili ko na hindi ka pa handang kalimutan siya pero pinabayaan ko lang kasi akala ko darating din yung time na masasabi mo sa akin na "I already moved on"" -I used to be the one making you smile. Bakit kasi ang gago ko? Narinig ko ang mga halakhak niya na ako dati ang dahilan. I saw how her eyes smile whenever shes very happy. I miss it. I miss her. -"I'm always careful , sa isang bagay lang hindi." Makahulugan niyang sabi bago tumayo at naglakad paakyat. -Someday I can forgive you but now let me enjoy the pain you cost me. There's good to those who waits. Everything happens for a reason, you just have to trust the moment and the person you are with. --------------
Love Confessions Society Series 6: Adam Leongson (Tanangco Boys Batch 2) by Juris_Angela
17 parts Complete
"I will never let go of this hand. If you find the situation too hard for you. Then, share your pain with me. You don't have to be alone anymore." Teaser: A Princess' Confession I am broken inside. I wanted to scream. I even cried out for help, but no one's there, except darkness. Nobody held my hand when I reach them. Sinubukan kong sabihin sa kaibigan ang sitwasyon ko. Pero tinawanan lang nila ako, ang sabi nila, it's all in my mind. Damn! The emptiness inside is killing me. Kapag nakaharap ako sa ibang tao, palaging pekeng ngiti ang binibigay ko sa kanila. Nagkukunwari na okay lang ako, na maayos ang lagay ko. Pero sa gabi ay hindi ako pinapatulog ng kalungkutan na halos mag-iisang taon ng unti-unting pumapatay sa akin. I'm trying to be a better person that my Dad wanted me to be, pero hindi ko kaya. Sa bandang huli, I am a failure. Because I can never meet his expectation. When his Assistant who was that time my private tutor, sexually molested me, wala pa rin akong nagawa, ni hindi ko magawang magsumbong dahil natatakot akong saktan niya si Daddy. So, I kept that nightmare in me. When my best friend died, everyone blamed me. Maybe, yes, it was my fault. At sa loob ng ilang taon, parang bangungot na paulit-ulit nagre-replay sa aking isipan ang paninisi ng mga tao. Hanggang sa dumating ang araw na wala na akong makitang dahilan para huminga. And then, I begged. "Please, let me escape this pain. I can't take it anymore." Nakasilip ako ng pag-asa ng dumating ka sa buhay ko. Nangako ka na sasamahan ako sa lahat ng laban ko. Akala ko magiging okay na ang lahat. Pero nagkamali ako, lahat ng mayroon tayo, lahat ng ito ay bunga lang ng iyong awa.
Love is Like a Game [Book 1 Complete] by loveisjustashow
29 parts Complete Mature
Content warning ⚠️ SPG "Ang kwentong ito ay may halong kalibugan na hindi angkop sa mga mambabasang PAVIRGIN patnubay ng mga experto ang kailangan" There is a book 2 "The story of us" https://my.w.tt/6Gl18HqBW9 Book 3 https://my.w.tt/x3MRCrtBW9 GAY STORY ( SPG) Minsan si tadhana mapaglaro akala mo siya na pero yun pala kukunin din sayo Bakit kasi kailgan pa magmahal kung masasaktan ka din lang Ang pag ibig ay parang larangan ng laro kung hindi ka handa at bihasa sa pakikipag laro madadaya ka. Destiny ang kalaban ng dalawang nagmamahalan There are some SPG part so good luck There is a book 2 "The story of us"
Why Can't We Be? (TAGALOG STORY) by yzavenice
83 parts Complete
Lucky are those who already found the love of their lives, those people living and spending times with their dearest. However, there are some lovers who found each other but never been together for whatever reasons. There maybe times you regret those reasons you said, even actions you did from the past and would just say "If only..." "What if..." And beneath your heart you're wishing for something to happen, you are still hoping that its not yet the end of everything for you and to your love. You are wishing, praying for another chance. But, what if you have given another chance what will you do? Will you just waste it? Or embrace it with all your heart and give all what you can give for your love? Kian and Sai both know kung ano ang feelings nila para sa isa't isa. Pero sadya yatang minsan kahit gaano pa kagusto ang bawat isa may mga nakikita at kahit anong mangyari makakahanap at makakahanap pa din ng mga dahilan para pigilan ang sarili na ibigay ang dapat para sa minamahal. Masakit man ito para sa iyo, at maging para sa minamahal mo pero kung pakiramdam mo iyon naman ang tama mong gawin, yun ang gagawin mo. Kagaya ni Sai, huli na nang marealized niya kung gaano kalaki ang nagawa niyang pagkakamali, pinipilit niyang hwag pagsisihan ito pero makakaya kaya nyang hindi iyakan ang maling desisyong ginawa nya? Kung sa araw-araw na lang ng ginawa ng Diyos ay nakikita niya ang lalaking kaniyang minamahal pero kaniya namang sinaktan.
The Promise (Complete) by dreamerhime
14 parts Complete
"For richer, for poorer, in sickness and health, till death do us part. Please wear this ring and promise me that you will not remove this because this is sign of my undieying love." Yan ang pangako mo sa akin ng kinasal tayo, pangako na araw-araw kong pinanghahawakan. Pero bakit kaylangan mo magbago ng malaman nating wala akong kakayahang magdalang tao. Alam kong sabik kang magkaroon ng sariling pamilya dahil lumaki kag nag-isa at tulad mo, gusto ko rin tayo magkaroon ng pamilya. Pero dahil sa akin di mo makakamit ang minimithi mong pamilya at dahil dun nag bago ka. At sa araw-araw na pagbabago mo ang pangako mo lang sa akin ang pinanghahawakan ko. Pero hanggang saan ko ito kayang panghawakan. A/N: This story is work of fiction. Any scene, characters or anything that have same to the other stories are purely coincidence. Please inform me politely. Disclaimer: I do not own the pictures I use. All images or videos are purely for imagination purposes. Credits to the following for the images that I used to my book cover from freepic Freepic diller, Senivpetro, Topntp26 Hope you can support me and my stories. Thank you.
X mEEts X by Hus2BbLame
35 parts Complete
Paano kung may boyfriend ka pero sa txt mo lng nakillala?? Di kayo nagkta pero madalas naman kayong magttxt at mag-usap. Pero that was just sa umpisa kase nang lumaon, wala na....ni isang "HI" sa txt wala; kahit isang "HELLO" sa tawag ay wala rin... .....................kaya akala mo "BREAK NA KAYO"....... Lumipas ang panahon. Dumating si crush slash..naging bestfriend mo. akala mo magging kayo pero barkada mo pla ang gusto. No choice ka!!!!(<alangan nmang paghiwalayin mo cla...GAGA!!!>)..kelangan mong mag- move on, dba?...pero pano kung sa kalagitnaan ng iyong pagmomove on, dumating si unexpected guy!!!!... ,,,,,,PAno kung magpaparamdam uli ang ex mo?? at pinipilit niyang meron pang "kayo"?? anung gagawin mo??,,,,, <<<MaMaHaLiN mU ba uLiT si X (boyfriend) >>>>> o <<<magfofocus nLnG sa pgLiMut sa isa mo pang X (bestfriend)???>>>> "WHO'S YOUR BET??YOUR X - BOYFRIEND OR YOUR X - BESTFRIEND????"
The Taste of HER COMEBACK (The Tears of the Martyr Wife) Book 2 by LuckyAvigail
36 parts Complete Mature
(COMPLETED) ( UNEDITED) Are you ready for her sweetest comeback? When they say never underestimate the Woman's power Elle mean it. And now she's here to proved na hindi lahat ng nasaktan hindi na kayang bumangon, she's here to proved the Girl's power, ang Asawang nasaktan, ang babaeng niloko at pinagsamantalahan at higit sa lahat ang nagmahan na ginawang basura lang ay nandito na, nagbabalik para patunayan sa lahat ang kayang gawain ng Isang taong nagmahal, sinayang, niloko, at sinaktan. Not your ideal love story, not your ideal story, not your ideal sequence of events, not your ideal list of characters, not your ideal main and when you read it read with understanding and heart, because this is not perfect like others story Read at your own Risk, lalo na't may mga bad words ito kung ayaw niyo dito wag niyo na ituloy pumasok para magbasa. BALALA:Nakakapaso, wag magpapadala baka masunog. sinayang,niloko at sinaktan. Start:7/29/2022 End:9/26/22 Book 1:The Tears of the Martyr Wife Book 2:The Taste of HER COMEBACK
A Day before his Wedding by Inkspiring_B
34 parts Complete Mature
Kapag nagmahal tayo ay magagawa natin yung mga bagay na hindi natin ineexpect na magagawa 'no? Magiging tanga tayo kahit alam nating matalino tayo ng dahil sa pag-ibig. Paano ang gagawin mo kung yung lalaking minahal mo na sinaktan ka dati ay magbalik? Magbalik na may kasama ng bagong babae at papakasalan? Pero paano kung magawa mong magkaroon ng affair sa lalaking minahal mo? Ang pinakamahirap na desisyon ay ang magmahal ng lalaking alam mong hindi mo na pag-aari at kahit alam mong mali ay hindi ganon kadali tapusin. Minsan sa pag-ibig, Hindi sapat na mahal niyo lang ang isa't isa. Hindi sapat na magkasama kayo lalo na kung alam niyong may matatapakan kayong tao na wala namang nagawang pagkakamali sainyo. Loving a person in a wrong timing isn't easy but how they can pass those struggles until the end? How they will fight their love until the end knowing that they will hurt someone else?
You may also like
Slide 1 of 8
BERNARDO SERIES 1:ALICIA BERNARDO(COMPLETED) cover
Love Confessions Society Series 6: Adam Leongson (Tanangco Boys Batch 2) cover
Love is Like a Game [Book 1 Complete] cover
Why Can't We Be? (TAGALOG STORY) cover
The Promise (Complete) cover
X mEEts X cover
The Taste of HER COMEBACK (The Tears of the Martyr Wife) Book 2 cover
A Day before his Wedding cover

BERNARDO SERIES 1:ALICIA BERNARDO(COMPLETED)

22 parts Complete

BERNARDO SERIES 1: ALICIA BERNARDO -" Mahal kita pero yung pagmamahal mo ang hindi ko maintindihan. Mali let me rephrase that mahal mo ba talaga ako o nangungulila ka lang sa kanya.? Naalala mo ba nung nagkasagutan tayo dahil don? Alam ko na sa sarili ko na hindi ka pa handang kalimutan siya pero pinabayaan ko lang kasi akala ko darating din yung time na masasabi mo sa akin na "I already moved on"" -I used to be the one making you smile. Bakit kasi ang gago ko? Narinig ko ang mga halakhak niya na ako dati ang dahilan. I saw how her eyes smile whenever shes very happy. I miss it. I miss her. -"I'm always careful , sa isang bagay lang hindi." Makahulugan niyang sabi bago tumayo at naglakad paakyat. -Someday I can forgive you but now let me enjoy the pain you cost me. There's good to those who waits. Everything happens for a reason, you just have to trust the moment and the person you are with. --------------

More details