Story cover for Soar by shebephoebe
Soar
shebephoebe
  • WpView
    MGA BUMASA 139,800
  • WpVote
    Mga Boto 9,491
  • WpPart
    Mga Parte 43
  • WpHistory
    Oras 10h 17m
  • WpView
    MGA BUMASA 139,800
  • WpVote
    Mga Boto 9,491
  • WpPart
    Mga Parte 43
  • WpHistory
    Oras 10h 17m
shebephoebe
Kumpleto, Unang na-publish Oct 19, 2015
adventuredragondragon-riderdragon-ridersdragonsfantasyflightflyingfreedommedievalmedieval-medieval-fantasyslavewar
Please note: this is a third-draft story but is not revised. 

More than a century ago, dragons and the blue-eyed Shaderi flew together. Then they were brought down by jealous men who feared their power. Now blue eyes are a curse and dragons are a laughingstock, neither seen outside of slavery.
  Born a slave, her fair features mark her as a witch who is worth less than even the right to a name. He is a dragon who was raised in the arena, a life that left him unable either to fly or to breathe fire.
  Thrown together by an ambitious showman, they are united by a bond as old as the legends. Together, they have a hope for something more than the lives to which they were born, if only they can learn to trust each other.
  The words of a mysterious minstrel point them west, where rumors say their people live in freedom. The road there is hard, and at the end of it they find themselves a world embroiled in a secret war. This new world is ruled  by a king who values tradition above all else. At every turn their new friendship is tested, and they are forced to decide how much they are willing to pay for a place to call home.
  He wants to help her learn the truth of where she came from, and she wants to give him what every dragon deserves: a chance to soar.
All Rights Reserved
adventuredragondragon-riderdragon-ridersdragonsfantasyflightflyingfreedommedievalmedieval-medieval-fantasyslavewar
Table of contents

43 parte

Sign up to add Soar to your library and receive updates
o
#511flight
Mga Alituntunin ng Nilalaman
Magugustuhan mo rin ang
A Prophecy of Fire ni Scottish_writer
17 parte Ongoing
Legend of the Torchbearer - Book One Most children are lulled to sleep by softly sung lullabies or the sound of snoring family members, I fell asleep to the roar of dragon-song thundering through the mountain known as Beinn Na Nathrach; named for the creatures who first made it their home. Dragons roamed the world long before men, and at their height, nobody could have foreseen their downfall. Now Beinn Na Nathrach is the last nest, and the riders of Dùn Ceò - the ancient fortress carved into the mountainside - are the crumbling remnants of a once noble and powerful sept of armies the world over. As an orphan brought up within the walls of a dragon keep, following orders and watching the riders train is as close as I'll ever get to joining their ranks. Life for me is laid out as a servant, with my place secure as the ward of one of the commanders. I can see it ahead of me; the years of mucking out stables, fetching food, mending clothes and equipment, when all my heart aches for is to know how it feels to see wings stretched out either side of me. Yet the monotony of life is shaken when a hatchling is found in the forest, and rumours of rebellion in the most Northern villages begin to spring up. But why would a few unruly farmers require an entire contingent of well-armed soldiers who seem overly interested in the goings on in Dùn Ceò? If the hatchling didn't come from the last known nest, where did he come from? And what does it have to do with a legend told as a bed time story?
Dragon Rider (#Wattys2016) ni SilentSilverSlip
53 parte Kumpleto
Under the rule of a Dragon Riders and Magicians, young 14 year old Thea finds herself pulled into the Dragon Riders world. After her brother dies she finds a dragon and looks after it, but it was the Dragon Riders who killed him. When she finds herself becoming a Dragon Rider, she fights them off however she is captured. Thea soon finds herself surrounding by new people and dragons. As Thea learns more she makes new friends and tries to figure out ways to defeat the Dragons Riders, and joined by her friends she rebels against their rule. But when no one has their own dragon? Yeah things get a little tricky then. Snow Storm is Thea's own dragon, however they were separated and Storm has to first escape the clutches of the Magicians and Dragon Riders. Easier said then done, especially when he wants to help the other dragons. Storm and Thea are on a journey to find each other but both of them are putting their friends before them. While learning more about dragons Thea finally understands what is really happening. But Storm seems to be gaining powers, that are out of control, the more he tries to help, will they ever find each other again?
Ashes and Embers ni CocoNova63
23 parte Kumpleto
Long before the floating kingdoms were built, the skies belonged to the dragons alone. Humans feared the skies and the creatures that ruled them. But everything changed when dark forces called Velkraths emerged from the earth - twisted echoes of dragons, corrupted by ancient magic and hunger. They began to burn the kingdoms from the skies downward. Desperate to save her people, a girl named Aerin climbed the highest peak to plead with the dragon Esharion. Instead of taking her life, the dragon saw her courage and bound his soul to hers. In that moment, the first dragon-rider bond was forged - a sacred link of minds and hearts. From Aerin and Esharion, the order of dragon riders was born. Dragons bond to their riders from birth, and when the rider comes of age, the dragon seeks them out. Over centuries, the riders defended the floating kingdom of Aerithal, their bond holding back the Velkraith threat. Yet the bond is dangerous-if one dies, the other often cannot survive the loss. Two childhood best friends, Riven, a quiet and loyal dragon rider, and Lyra, a bold and fiercely independent warrior-have trained side-by-side since they were twelve. Bound to their dragons, Virex and Sora, they've fought countless battles and saved each other's lives more times than they can count. But while Lyra sees Riven as her anchor and brother-in-arms, Riven has silently loved her for years. Lyra, however, is infatuated with Xanten, a charming and noble prince from the kingdom to the South called Medana. When an ancient, giant, monstrous dragon awakens, threatening to destroy their kingdom, Riven and Lyra are chosen for a perilous mission. As they venture deeper into enemy lands, Riven struggles with his feelings, caught between wanting Lyra to know the truth and fearing it would ruin everything they've built
Blood & Ashes ni Dahlia_0208
19 mga parte Ongoing Mature
The Kingdom of Vareth was built on dragon fire, ruled by riders feared across the realm. But not all who enter the Dragon Rider Quadrant come for honor. Princess Verena Corvin refuses to be caged by crown or duty. Disguised as a recruit, she risks treason to claim her freedom in the Quadrant. Survival should be her greatest challenge. But then there's him. Grayson Ashford-ruthless rider, feared legend, and sworn enemy of her bloodline. He's waited years for revenge, and now the daughter of the man he despises has walked straight into his domain. He'll break her. Make her fail. Watch her fall. But Verena is not the fragile royal he expected. Every strike meant to ruin her only sharpens her fire. Every obstacle only steels her will. And when a rogue, untamable dragon chooses her, she becomes impossible to erase. Hatred turns to obsession. Loathing twists into dangerous attraction. The harder he pushes, the harder she pushes back-until their fury burns hotter than dragon fire. But war is coming, secrets are unraveling, and Grayson's vengeance may cost them both everything. She was supposed to be his enemy. So why does he keep saving her?
Rise of Fire: Dragons Reborn [COMPLETED] ni RosaleeRain
49 mga parte Kumpleto Mature
The world had long since forgotten the age of dragons, those creatures that had once ruled the skies as gods had long since disappeared after the conclusion of the Great Demon Wars. Dragons became nothing more than a fading legend, a story to tell children at bedtime. But the gods could not let the dragons die, for they were the last defense against the demon armies and the dark god Vekkar. Talia had been born and raised in a world of darkness acting as an agent of Hephatus, goddess of assassins and death. She knew only a life of killing, sometimes for justice, sometimes for honor, always for money. Her morals were opaque at best. But when she's deployed to the city of Arboros she finds herself thrust into a world of political games, opposing powers, and constant threat. Nowhere was safe even for her. Her goals became muddied, and then lost altogether when she meets the Dwarven Prince. Bromyr had spent the last five years of his life chasing ghosts, desperate to find the lost dragon eggs. His people thought him crazy, his father stripped him of his titles, but he never gave up. Eventually his effort bore fruit and he hastily made way to return to his homeland only to get caught up in the city of Arboros. It was there that he met an intriguing half-giant, a woman who ignited a fire everywhere she went. In the end she was the one who inadvertently brought about the new age of dragons. What could go wrong when an ill tempered assassin becomes the first dragon rider of a new age? ***Cover made by annie1loves1you***
A Dragon's View [Book 1 in Rising Dragons] ni SilentSilverSlip
36 mga parte Kumpleto
Seeryath is a three year old dragon with a horrible past, however things start to look up when she is taken to a dragon academy for reasons unknown to her. Sky is a dragon rider except she's missing the dragon, Sky's been at the academy for years without a dragon and that's not a good thing. The two meet by chance and begin to bond however when Sky stands up for herself and almost dies because of it, Seeryath comes to the rescue. As dragon and rider the two make dangerous enemies and tensions start rising as people start fighting amongst each other. Sky and Seeryath think they know who's behind it all however the moment they can prove it disaster strikes and the moment of order turns to chaos. With help of new friends Sky and Seeryath rise up against their enemies. Though a war has started and the odds are low for the dragon riders to win and sometimes the worst does happen. ******************* Told from a Dragon's point of view. Cover by Wishingfornow. Book 1 in the Rising Dragon series
Angel Academy ni Obsidian9302
65 parte Kumpleto
For years angel academy has taught students of all races and ability's, angels, werewolves, vampires, dragon riders, you name it. The school was created for a purpose, to help students reach their full potential and rise against the demons that vow to destroy the world as we know it. But one girl changes everything. Nobody has seen her powerful kind for thousands of years. Her power could bring about the victory or downfall of every supernatural aspect. To everyone around her she is just an ordinary werewolf with and unordinary appearance but in reality she is much more. She is a Mythica. She always knew she was different. She was told to keep her powers hidden, that people would fear her for who she is. But now. Everything is going to change. ----------------------------- There WILL be dragons !! ----------------------------- ***There may be some colorful language and violence. All rights reserved, this is my own work so please DO NOT copy anything without asking permission. Original images may be subject to copyright*** HIGHEST RANK : #1 in fantasy #1 in dragons
Reincarnated as Dragon's Sacrificial Bride ni glow_wave
55 parte Kumpleto
Synopsis: Aeris had never known love. As an orphan, she had spent her life yearning for warmth, for a place to call home. When she finally found someone who made her feel wanted, she clung to the illusion, believing that maybe-just maybe-she was no longer alone. But that illusion shattered the day she saw her lover in the arms of another woman. "You're pathetic," he sneered when she confronted him. And with one cruel shove, he sent her crashing against the wall. Pain struck her like a bolt of lightning, and then-darkness. She thought it was the end. Instead, she woke up in the body of a breathtaking maiden with long, silk-like black hair. Her limbs were bound, her vision blurred, and before she could even comprehend what was happening, she heard the chants of a ritual. She was being sacrificed-as a bride to a dragon. The people around her whispered prayers, their eyes filled with fear. They were offering her to him-the mighty, fearsome dragon lord who ruled these lands with fire and fury. She wasn't just anyone now. She was the chosen offering-the bride meant for the Dragon King. A being of pure darkness, a ruler feared across the world. They said he was a monster, a black-scaled dragon with a presence so overwhelming that the very air trembled in his wake. He controlled the elements and wielded power beyond imagination. He was ruthless, merciless, and unseen in his human form. No one had ever escaped his grasp. And now, she belonged to him. As the sky darkened and the great dragon descended from the heavens, his massive wings casting shadows over the trembling villagers, she finally saw him. Glowing red eyes, burning like molten fire, locked onto hers-not with rage, not with hunger, but with something unexpected. Curiosity. Possession. Fate had given her another chance. But was it a blessing or a curse? ---
Ugly, A Story About Dragons, Riders, and Witches ni -naosu-
1 parte Kumpleto
This is a fantasy theme, with magic, witches, dragons. This is a story with a female strong lead surrounded in mystery & unknown; not to mention being chased by huge wolves, undead, & necromancers. Summary; Kollbaine is fleeing into the frozen north flying as fast as he can away from his own pursuer, when he sees a small moving speck in the distance of a frozen wasteland. There are too many wolves in these parts, and no people. Even as he watches and strains his eyes he sees the need to pour out as much speed as he and Howl can muster. There's a girl ahead surrounded by a pack of wolves, and she's about to be eaten. If they can only make it in time! But he and Howl are both already exhausted and wounded. They are also still being pursued themselves by another enemy rider and his dragon. What will happen when his pursuer catches up?
Taniel (The Taverner's Daughter I) ni ChristineJRandall
113 parte Kumpleto
THE TAVERNER'S DAUGHTER - BOOK ONE FANTASY, MAGIC, DRAGONS, ROMANCE, WINGED WIZARDS. Please Note: The rest of this series will not be published until the complete series is drafted and revised - probably another four volumes over the next year. However, this book doesn't end on some really bad cliffhanger, and I think it has a satisfactory 'end' feel, so do read it if you wish. After mistaking a leather-clad wizard for a dragonrider, the taverner's daughter agrees to binding vows: Jarryd hopes for a magic-saving paternity spell but Taniel just wants his dragon. Of course, it is not that simple. It never is. Others have plans for Taniel and can do without Jarryd's interference. Taniel's father is little help, too busy dealing with a guilty conscious and pining for his missing wife. Add talking dragons, kidnappings, a gallivanting Grandmaster Wizard, a wicked stepfather, seductive shape shifting winged wizards, and midwitchery. Stir with rumour of plotting land-locked pirates, spies, feisty forest sprites, rockgoblins, and a failing magical barrier. Welcome to the world of A Corrangorachian Fantasy. SOME MILD MATURE MOMENTS (but maybe not enough to mark MATURE): A few not-particularly-graphic sex scenes. Violence? Could get nasty, depending on your perception. Drug Use? Pipe smoking, copious alcohol, and the odd potion. And some coarse language, of course. (AUSTRALIAN - BRITISH ENGLISH)
Magugustuhan mo rin ang
Slide 1 of 10
A Prophecy of Fire cover
Dragon Rider (#Wattys2016) cover
Ashes and Embers cover
Blood & Ashes cover
Rise of Fire: Dragons Reborn [COMPLETED] cover
A Dragon's View [Book 1 in Rising Dragons] cover
Angel Academy cover
Reincarnated as Dragon's Sacrificial Bride cover
Ugly, A Story About Dragons, Riders, and Witches cover
Taniel (The Taverner's Daughter I) cover

A Prophecy of Fire

17 parte Ongoing

Legend of the Torchbearer - Book One Most children are lulled to sleep by softly sung lullabies or the sound of snoring family members, I fell asleep to the roar of dragon-song thundering through the mountain known as Beinn Na Nathrach; named for the creatures who first made it their home. Dragons roamed the world long before men, and at their height, nobody could have foreseen their downfall. Now Beinn Na Nathrach is the last nest, and the riders of Dùn Ceò - the ancient fortress carved into the mountainside - are the crumbling remnants of a once noble and powerful sept of armies the world over. As an orphan brought up within the walls of a dragon keep, following orders and watching the riders train is as close as I'll ever get to joining their ranks. Life for me is laid out as a servant, with my place secure as the ward of one of the commanders. I can see it ahead of me; the years of mucking out stables, fetching food, mending clothes and equipment, when all my heart aches for is to know how it feels to see wings stretched out either side of me. Yet the monotony of life is shaken when a hatchling is found in the forest, and rumours of rebellion in the most Northern villages begin to spring up. But why would a few unruly farmers require an entire contingent of well-armed soldiers who seem overly interested in the goings on in Dùn Ceò? If the hatchling didn't come from the last known nest, where did he come from? And what does it have to do with a legend told as a bed time story?

Karagdagang detalye