Regal Of All
WinterDuchess
  • Membaca 620
  • Suara 40
  • Bagian 21
  • Durasi 1h 57m
  • Membaca 620
  • Suara 40
  • Bagian 21
  • Durasi 1h 57m
WinterDuchess
Lengkap, Awal publikasi Okt 23, 2015
arrowscompetitiondragonsfantasyfirefriendshiphappymagicswords
A competition in a mythical land brings three girls together to face their largest challenge yet, one of the most famous fantastical beasts that threatens not only their lives, but the whole kingdom's.

It's fun fiction.
.::Read it::.

~W. Duchess
P.S. this IS complete :)
Seluruh Hak Cipta Dilindungi Undang-Undang
arrowscompetitiondragonsfantasyfirefriendshiphappymagicswords
Daftar isi

21 bab

Daftar untuk menambahkan Regal Of All ke perpustakaan Anda dan menerima pembaruan
atau
#127arrows
Panduan Muatan
anda mungkin juga menyukai
Magic and Nightmares! oleh blair_13-14
5 Bagian Sedang dalam proses Dewasa
Living your life in this world isn't easy. Belonging to a forgotten house and being seen as an outcast isn't the best. Being told you are also the heir of said forgotten house isn't normal! Yet it just so happened to Crystal, who just wanted a straightforward life. Whilst dealing the with the disturbing and psychotic thoughts in her head as well as the frustrating Gods her mother some how was friends with. And starting the impossible climb in the hierarchy in the new school she is sent to, she must somehow become a general, a wife and a hunter... Doesn't sound like this is going to be so straightforward after all! *** Hope you enjoy!! TW: mature themes, strong language, traumatic themes, graphic violence, sexual innuendos, sexism, arranged/forced marriage, neglect. And probably many more. Read at your own risk. ©️ All rights reserved.
Wings and Steel oleh OneNightIDreamt
26 Bagian Lengkap
[THIS STORY IS COMPLETE] In a world where Fairies face racism and hardships, a brave young woman of their kind will join the fight against a dangerous drug humans had created. However, a small victory comes with a tremendous price. Broken and alone, with the humans hot on her trail, she seeks refuge amongst a people everyone thought extinct. But her troubles don't end there, for dangers lurk around each and every corner...
Portal Jumpers oleh OliviaClawed
22 Bagian Lengkap Dewasa
Normal girl thrown into a world of magic, where she finds, friends, romance, and her birthright.
Jack Rivers & The Isle of the Immortals oleh DRCarmel
10 Bagian Lengkap
Join Jack in a delightful adventure as he tries to protect the immortals.
The Third Wedding oleh HuffleHeArt
31 Bagian Lengkap
This is my story, essentially these are real events I've lived through and I'm processing it by writing it down as a fairytale. It's probably fine. THIS IS DEDICATED TO MY FRIENDS: You are the ONLY ones who got me through all of these struggles! Thank you for saving me everyday. To me, you are the magic, thank you!
Archery Love?? oleh suriyayeasmin
42 Bagian Lengkap Dewasa
In a world where extraordinary powers determine one's worth, a young girl faces the ultimate test of love and duty, as she must sacrifice her life to save the boy she loves, amidst a fierce struggle for rank and the selfless sacrifices of others striving to protect humanity.
fιяєвℓσσ∂'ѕ ¢яєѕт oleh Dragoness_Writes
7 Bagian Lengkap Dewasa
Read to find out
Cursebreaker [Dreams - I ] oleh FairySalvatore
38 Bagian Lengkap
Aislin, girl on earth. Ayduin, Prince of Elm Lenora, Land of Ice Elves. No connection, no way to meet. Both live in two different worlds. Prince is cursed that whichever land he rules shall perish, Girl is cursed that whoever loves her will die. When both start talking through dreams, two lands and magic combine and one of them is a curse breaker for another while other is doomed with tragedy. ~It's in the land of dreams that we find what we wish for~ PART I of Dreams series
Beast Venture oleh Hauntaku
13 Bagian Lengkap
Two girls from a world where magic is mere myth discover a portal into a fantasy realm. All of my works are dedicated to the public domain.
anda mungkin juga menyukai
Slide 1 of 9
Magic and Nightmares! cover
Wings and Steel cover
Portal Jumpers cover
Jack Rivers & The Isle of the Immortals cover
The Third Wedding cover
Archery Love?? cover
fιяєвℓσσ∂'ѕ ¢яєѕт cover
Cursebreaker [Dreams - I ] cover
Beast Venture cover

Magic and Nightmares!

5 Bagian Sedang dalam proses Dewasa

Living your life in this world isn't easy. Belonging to a forgotten house and being seen as an outcast isn't the best. Being told you are also the heir of said forgotten house isn't normal! Yet it just so happened to Crystal, who just wanted a straightforward life. Whilst dealing the with the disturbing and psychotic thoughts in her head as well as the frustrating Gods her mother some how was friends with. And starting the impossible climb in the hierarchy in the new school she is sent to, she must somehow become a general, a wife and a hunter... Doesn't sound like this is going to be so straightforward after all! *** Hope you enjoy!! TW: mature themes, strong language, traumatic themes, graphic violence, sexual innuendos, sexism, arranged/forced marriage, neglect. And probably many more. Read at your own risk. ©️ All rights reserved.

Detail lengkap