Chimera: A Dark Fairytale of Love
NishiSerrano
  • Reads 60
  • Votes 15
  • Parts 6
  • Time 46m
  • Reads 60
  • Votes 15
  • Parts 6
  • Time 46m
NishiSerrano
Ongoing, First published Oct 31, 2015
appleschimeradarkfairytalefantasyfolkloremadnessmysteriousotherworldlythriller
On his journey home, a handsome knight hears talk of a wealthy princess living in solitude on an island. His new quest takes an unexpected turn when he finds the princess, who binds him to a promise to never touch her apples. However, it is her wealth he seeks. His own dark secret is challenged and rivaled by the strange, beautiful woman he weds and attempts to destroy as he spirals into madness.
All Rights Reserved
appleschimeradarkfairytalefantasyfolkloremadnessmysteriousotherworldlythriller
Table of contents

6 parts

Sign up to add Chimera: A Dark Fairytale of Love to your library and receive updates
or
#65apples
Content Guidelines
You may also like
Imaginary Psychopath Taehyung by RitikaSaini789
20 parts Ongoing Mature
based on :- mental disorder violence , mysterious romantic . This is my first fan fiction English is not my first language so, please corporate. please watch till the end 🙏🙏 let's go oh yeah don't forget " night apple is poison apple" 😉✌️
The realm beyond the pages by TheWanderingScribe
8 parts Ongoing
Follow the journey of Emma, a young girl thrust into a mysterious world through the pages of a book. In The Realm Beyond the Pages, she encounters enigmatic creatures and uncovers secrets shrouded in ancient magic. As Emma delves deeper into this unfamiliar land, she faces a dark presence that threatens to unravel everything. What lies at the heart of this magical realm? Discover the secrets that await in a world where every moment is cloaked in mystery.
THE HEART OF SHADOWS by ke_nzie4u
7 parts Ongoing
"Beyond the veil of the mundane, where shadows danced and whispers spoke secrets, a young woman named [Camilie] stumbled upon a hidden path. A path that led her to the threshold of a realm both wondrous and treacherous - the domain of the Demon King. Here, time was a river that flowed in circles, and the very air was alive with ancient power. And [camilie] was about to find herself swept away by a love that would change the course of her destiny forever."
Love's Dagger by n1cold
13 parts Complete
After the kingdoms local bandit, Freya, is finally captured, Prince Aillard must address the punishment for her. Before long though, he gets abducted himself by Freya. She tells him of a deal she's made to trade him in for a reward beyond anyone's imagination. What journey will follow these two as they travel through vast lands to reach their destination? Read Love's Dagger to find out.
Discovering [COMPLETED] by Idgafl
27 parts Complete
Having a bear as a best friend was good for the long run, but it's turned into being a disaster. I lost my entire family to war. The bear that I had spent my entire life with has betrayed me. And now I have to leave what I've learned in the past two or three months to get answers from a place that might not even exist. Will it all really be worth it? I'm putting my friends lives in danger because they chose to help me with my mysterious and torturous life. What more could possibly go wrong? Did I mention that I now have a giant killer pet wolf? Oops. {EDITING}
My Dearest Opposite(a Romeo and Juliet type story) by SeraVladimer
9 parts Complete
In a world where people use magic,they can use any type of magic but only four certain people have element magics.What happens when two opposites meet by chance how will their relationship blossom. I do not own any pictures but the characters are all mine and the story background is mine as well.
Finding the Wisest by Dreamlineexpress
30 parts Complete
Meet Maya, things aren't going so well with her. Her mother has just gone missing and she is going crazy trying to find her. Problem? She's kind of stuck in a strange place and desperately wants to get back home. Another problem? The people here don't even seem to know what a phone is. Follow this slightly reluctant heroine on her journey as she searches for her mother and finds that things are not always as they seem.
An Apple Sleep Experiment by The_Wonderful_Wonder
11 parts Complete Mature
It's zap apple season again and the Apple family is in hot water. An enormous debt, unrelenting heat, and an ill Big Mac forces Applejack to turn to Twilight for a potion that will keep her awake long enough to get the work done. It works like a charm... until she realizes that it isn't wearing off. Terrible things happen to a pony deprived of sleep... Applejack's mind turns to madness and she becomes a monster hell-bent on revenge.
Answers by Serenity811
22 parts Complete
This is a tale About darkness And light As fate intertwined their story As an answer to each other's prayer ~~~ Two young people looking for an answer for a crucial part of their life. How will their story intertwine to look for the answer they seek?
The Mice in the Kitchen by monicaeuen
35 parts Complete
In pursuit of a new life, three beings meet by chance without knowing that this encounter will decide their fates. Mice, spells, princes and poisoned apples. This is not a fairy tale... or is it?
You may also like
Slide 1 of 10
Imaginary Psychopath Taehyung cover
The realm beyond the pages cover
THE HEART OF SHADOWS cover
Love's Dagger cover
Discovering [COMPLETED] cover
My Dearest Opposite(a Romeo and Juliet type story) cover
Finding the Wisest cover
An Apple Sleep Experiment cover
Answers cover
The Mice in the Kitchen cover

Imaginary Psychopath Taehyung

20 parts Ongoing Mature

based on :- mental disorder violence , mysterious romantic . This is my first fan fiction English is not my first language so, please corporate. please watch till the end 🙏🙏 let's go oh yeah don't forget " night apple is poison apple" 😉✌️

More details