Story cover for Canterlot Academy by LassTrainerKat001
Canterlot Academy
LassTrainerKat001
  • WpView
    Reads 194
  • WpVote
    Votes 8
  • WpPart
    Parts 13
  • WpHistory
    Time 1h 14m
  • WpView
    Reads 194
  • WpVote
    Votes 8
  • WpPart
    Parts 13
  • WpHistory
    Time 1h 14m
LassTrainerKat001
Ongoing, First published Dec 03, 2015
Mature
academyequestriagirlsfluttershymlpmylittleponyfriendshipismagicpinkiepierarityschoollifetwilightsparkle
[Note: THIS STORY IS UNDERGOING MAJOR CHANGES...apologies in advance]

In a place where everyone knows everyone, it can be quite nerve-wracking being the new girl. Especially when you've never set foot outside of your hometown and you're the greatest introvert known to mankind.

Unfortunately, that's the case for Canterlot Academy's newest student, Fluttershy. That is, until she meets a group of new friends who'll lead her on an exciting journey through life at the academy and all it has to offer! A new chapter in her life is just beginning!
Public Domain
academyequestriagirlsfluttershymlpmylittleponyfriendshipismagicpinkiepierarityschoollifetwilightsparkle
Table of contents

13 parts

Sign up to add Canterlot Academy to your library and receive updates
or
Content Guidelines
You may also like
Her Voice (Rarijack) by ohmyrarity
33 parts Complete Mature
"π‘Ίπ’Šπ’π’†π’π’„π’† π’Šπ’” 𝒋𝒖𝒔𝒕 𝒂𝒏𝒐𝒕𝒉𝒆𝒓 π’˜π’π’“π’… 𝒇𝒐𝒓 π’‘π’‚π’Šπ’." * * * * * * * * * ⚠️ THIS STORY IS UNDER HEAVY CONSTRUCTION; REVISING. AS IT CONTAINS A LOT OF INCORRECT GRAMMAR AND SPELLING! Read at your own risk if you wish! ⚠️ Rarity transfers to Canterlot HS, and meets Applejack, the odd mute girl who doesn't speak. She doesn't express or open up. She uses her voice to only speak to her best friends. For everyone else, she uses her notebook to communicate. Rarity wanted to know more about Applejack and her life, and why Applejack doesn't use her voice to speak. She wants to be her friend, and be the person who Applejack can trust or express her feelings to. She doesn't want her to keep all of it inside. Rarity doesn't know why but it feels like the right thing to do. Will Rarity make her open up? Will she change her? Can she help Applejack to be happy? Will Rarity be able to tear down Applejack's shell? ...Or will she fail? This story is a humanized version with magic in it. Disclaimer: I do NOT own My Little Pony, or any of their characters used in this story, I only own the storyline/plot! All rights goes to Hasbro. I do not own the art on the cover, all rights goes to the artist. I only edited the cover but please do not take it as your own and claimed that you made it! #1 in Mlpfanfic ~ [6.10.21] #1 in Rarijack ~ [5.20.20] #5 in MLP ~ [4.28.21] #11 in Mylittlepony ~ [12.4.19] #7 ~ [4/12/23]
Crimson Promise (A Sunlight FanFic) by NickSchultz2022
34 parts Complete
Sunset lives with Starlight, the vampire who turned her. One day she and her friends, Pinkie Pie, Rainbow Dash, Applejack, Fluttershy, and Rarity hear that a new student is transferring to CHS. They are all excited to welcome a new wondercolt to their school. Sunset and Pinkie Pie are the ones who decide to greet the new student. Upon meeting the student, whose name is Twilight Sparkle, Sunset realizes she has developed a crush on her. But being a vampire means that she could pose a danger to Twilight. She struggles to keep her vampiric nature a secret. But when an old enemy from Starlight's past comes into town, she realizes they are in danger. She and Starlight must keep their much stronger, much older enemy out of town. If they don't they could risk revealing their secret to all of Canterlot, if not all of Equestria.
Equestria Girls: Equal Marks (Book 6~Equestria Girls Series) by SandyDandygUrl
25 parts Complete
On this adventure, it's nothing like we've seen before! Something strange is going on with a new girl that Sunset Shimmer and The Main Six meet, who happens to be their world's Starlight Glimmer! And at a far away village, people don't seem like their normal-selves anymore. They have all become equal and being different doesn't count as a good thing to them. Not to mention, someone is trying to alter the events from the past, so that The Equestria Girls never became friends in the first place. ***** (Book 6: Equestria Girls Series) *Began Writing: June 26, 2019* *Completed: January 17, 2021*
Kiss by ApplejackM
44 parts Complete
AppleDash is in! Only if Pinkie wasn't jealous... Starting at Canterlot, and ending in a tough spot, will Applejack and Rainbow Dash make it through? Find out with a trip to the hospital, and night at a carnival, and a few magical kisses.
Twists of Friendship by WritingGayAsF
10 parts Complete
Rainbow Dash and Fluttershy are childhood friends, but everything changes when Luke enters their lives, stirring up feelings of jealousy in Rainbow. As they navigate through the twists and turns of their friendship, will they find the courage to confront their emotions and overcome the challenges that lie ahead?
Canterlot's Princessβœ… | Appledash AU (mlpeg) by _catradoraa_
17 parts Complete
It's the year 1864. The year Canterlot welcome their new ruler, Princess Applejack. But the Princess wishes to live a different life, away from obnoxious royals so she decides to run away on the day of her coranation. She then meets a mystical creature that was supposed to be banished hundreds of years ago but what the Princess didn't know is that they would both gain a great friendship with each other and they would maybe become more than friends...
What Am I? by ahaawhat
22 parts Complete
"𝒀𝒐𝒖'𝒓𝒆 π’Žπ’š π’‰π’‚π’‘π’‘π’š 𝒑𝒍𝒂𝒄𝒆." [COMPLETED] S U M M A R Y: Rarity is turning 13 and one question has been haunting her for a while. Is she really straight? Confused, she battles the rest of 7th grade with the same question - until something unexpected (well at least for her) happens. ~~ Book started: July 15, 2018 Book ended: November 18, 2019 ~~ STOP GIVING THIS STORY VIEWS, I WROTE THIS WHEN I WAS 13 πŸ’€ I edited the cover, art by Looknamtcn ;p
My Little Pony: Equestria Girls - The Victor of CHS by ShiniSilver
14 parts Ongoing
Being a student Canterlot High School is one hell of a trip. Especially for you and your sister. You met a slew of new friends that you never thought you would have, encountered a magical princess from another dimension, and somehow managed to beat and reform the #1 bully queen who was just in the wrong place at the wrong time. Needless to say, your time at this school has been a very interesting, one could say magical, experience. But after all that, what's next? Well, with a musical showcase coming up soon, and a trio of new students hiding a dark secret, it doesn't look like your magical adventures are over just yet. So come join me as I tell the tale of the adventures of the (L/N)'s at CHS. This story was inspired by other stories such as "The Savior of CHS" by Jordanwolfboy9743. If you enjoy this one, make sure to give those stories a read too, they are very well made. Disclaimer: None of the images, art, or music used are mine, everything used in this story belongs to their respective owners. My Little Pony and the Equestria Girls series are owned by Hasbro.
Banana Bus Squad in Equestria Girls(Cancelled) by _red117
37 parts Complete
Canterlot high is a new school for Vanoss and his friends. One day they were late for school and when they arrived there they met a girl named Twilight Sparkle. Soon Banana Bus Squad got their lives change after meeting Twilight. I don't own everything it's belong to their respectful owners.
Life Is A Game || MLP Equestria Girls by MaidenDemigod4Life
57 parts Ongoing Mature
(DISCLOSURE: this story is half SoarinDash, half additional plot stuff, which is usually what I do, so enjoy!) Canterlot High thought it would be free after their hectic Friendship Games and their terrifying time at Camp Everfree, and it really did seem like it at the time. For once, Rainbow Dash, Twilight Sparkle, Sunset Shimmer, Applejack, Rarity, Fluttershy, and Pinkie Pie thought their junior year would just be school. But things get a little crazy. Again. And it's not all about magic this time. Everyone hoped that Cadence would take over Crystal Prep's principal position, but Cadence never took the role. She got another offer abroad and decided to take it. And the students of Crystal Prep and Canterlot High will face the wrath of Principal Dolores Cinch -- the sister of Principal Abacus Cinch. She wants a rematch of the Friendship Games, with a few "minor" adjustments to the intensity. Dolores Cinch is up to no good. And Canterlot is in for some turbulence. But what's worse? Cinch has her eyes on a certain rainbow-haired girl as the trigger to her plan, whatever it may be. ALSO SOARINDASH!!! This is also a SoarinDash fanfic, haha!
You may also like
Slide 1 of 10
Her Voice (Rarijack) cover
Crimson Promise (A Sunlight FanFic) cover
Equestria Girls: Equal Marks (Book 6~Equestria Girls Series) cover
Kiss cover
Twists of Friendship cover
Canterlot's Princessβœ… | Appledash AU (mlpeg) cover
What Am I? cover
My Little Pony: Equestria Girls - The Victor of CHS cover
Banana Bus Squad in Equestria Girls(Cancelled) cover
Life Is A Game || MLP Equestria Girls cover

Her Voice (Rarijack)

33 parts Complete Mature

"π‘Ίπ’Šπ’π’†π’π’„π’† π’Šπ’” 𝒋𝒖𝒔𝒕 𝒂𝒏𝒐𝒕𝒉𝒆𝒓 π’˜π’π’“π’… 𝒇𝒐𝒓 π’‘π’‚π’Šπ’." * * * * * * * * * ⚠️ THIS STORY IS UNDER HEAVY CONSTRUCTION; REVISING. AS IT CONTAINS A LOT OF INCORRECT GRAMMAR AND SPELLING! Read at your own risk if you wish! ⚠️ Rarity transfers to Canterlot HS, and meets Applejack, the odd mute girl who doesn't speak. She doesn't express or open up. She uses her voice to only speak to her best friends. For everyone else, she uses her notebook to communicate. Rarity wanted to know more about Applejack and her life, and why Applejack doesn't use her voice to speak. She wants to be her friend, and be the person who Applejack can trust or express her feelings to. She doesn't want her to keep all of it inside. Rarity doesn't know why but it feels like the right thing to do. Will Rarity make her open up? Will she change her? Can she help Applejack to be happy? Will Rarity be able to tear down Applejack's shell? ...Or will she fail? This story is a humanized version with magic in it. Disclaimer: I do NOT own My Little Pony, or any of their characters used in this story, I only own the storyline/plot! All rights goes to Hasbro. I do not own the art on the cover, all rights goes to the artist. I only edited the cover but please do not take it as your own and claimed that you made it! #1 in Mlpfanfic ~ [6.10.21] #1 in Rarijack ~ [5.20.20] #5 in MLP ~ [4.28.21] #11 in Mylittlepony ~ [12.4.19] #7 ~ [4/12/23]

More details