Wattpad Book Reviews (OPEN FOR REQUESTS)
Rose_Mariano
  • Reads 6,828
  • Votes 187
  • Parts 54
  • Time 1h 26m
  • Reads 6,828
  • Votes 187
  • Parts 54
  • Time 1h 26m
Rose_Mariano
Ongoing, First published Mar 06, 2016
bookreviewscommentsnoharmintendedopinionsremarksreviewswattpadwattpadbookreviews
This book is all book reviews and author's notes and has no plot whatsoever.

Duh.

This book has spoilers.

Duh.

To those who are mad about my reviews or finds the ratings I give too low or too high, or thinks that I give a story too much or too little credit, please kindly accept that it is my personal opinion and taste towards a subjective subject and suck it up. 

I only review finished books but if you have an unfinished book and you need/want feedback, just tell me and I'll respond as soon as I can.

Oh, and this contains cursing. I sensored those words but some might've slipped un/intentionally.
Public Domain
bookreviewscommentsnoharmintendedopinionsremarksreviewswattpadwattpadbookreviews
Table of contents

54 parts

Sign up to add Wattpad Book Reviews (OPEN FOR REQUESTS) to your library and receive updates
or
#108reviews
Content Guidelines
You may also like
Wendizzy's Writer Room by Wendizzy
2 parts Ongoing
In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.
You may also like
Slide 1 of 1
Wendizzy's Writer Room cover

Wendizzy's Writer Room

2 parts Ongoing

In this book, you'll get a behind the scenes look at how your favorite characters were born, my creative process, and the dirty details never before revealed. Tex's Camp Q&A: Come sit by the fire and ask me whatever you'd like. We can roast marshmallows, tell scary stories, and hang out in the comments like a big, happy family. Gator's Backstage Pass: A place full of secrets. Learn the-sometimes embarrassing-details on how my wildest scenes came to life, facts about the characters, the process, and myself.

More details