Story cover for Kidnapped By MDE by LizzyTheW3ird0
Kidnapped By MDE
LizzyTheW3ird0
  • WpView
    Reads 892
  • WpVote
    Votes 52
  • WpPart
    Parts 22
  • WpHistory
    Time 54m
  • WpView
    Reads 892
  • WpVote
    Votes 52
  • WpPart
    Parts 22
  • WpHistory
    Time 54m
LizzyTheW3ird0
Ongoing, First published Mar 31, 2016
Mature
alexdoramebryanstarsfanfictionheythereimshannonjeydonwalejohnnieguilbertjordansweetokyledavidballskyledavidhallkylehallmdemdefanficmydigitalescaperobbyepicsausesammrochelleshannontaylorshyleshylersoundslikeharmonytylerhagen
Mature audiences only. May contain subjects not appropriate for some audiences. Viewer discretion advised.
Public Domain
alexdoramebryanstarsfanfictionheythereimshannonjeydonwalejohnnieguilbertjordansweetokyledavidballskyledavidhallkylehallmdemdefanficmydigitalescaperobbyepicsausesammrochelleshannontaylorshyleshylersoundslikeharmonytylerhagen
Table of contents

22 parts

Sign up to add Kidnapped By MDE to your library and receive updates
or
Content Guidelines
You may also like
Falling In Love ≫ c.a.d by lovablemendess
63 parts Complete
2 fans wanted to see their heros, but somethings go completely different and bad things happen. check it out to know more
𝐋𝐀𝐈𝐃𝐁𝐀𝐂𝐊, timothée chalamet by lipteint
31 parts Complete
───── ❝ 𝐥𝐚𝐢𝐝𝐛𝐚𝐜𝐤 ❞ ───── 𝘮𝘦, 𝘣𝘺 𝘢 𝘧𝘳𝘪𝘦𝘯𝘥, 𝘢 𝘧𝘳𝘪𝘦𝘯𝘥, 𝘣𝘺 𝘮𝘦. ⭒☆ ────────────── ☆⭒ （ 𝐭𝐢𝐦𝐨𝐭𝐡𝐞𝐞 𝐜𝐡𝐚𝐥𝐚𝐦𝐞𝐭 ） （ 𝐬𝐨𝐜𝐢𝐚𝐥 𝐦𝐞𝐝𝐢𝐚 𝐱 𝐫𝐞𝐚𝐥 𝐥𝐢𝐟𝐞 ）
social, 13RW ✓ by egotistics
42 parts Complete Mature
{13rw social media fic} part 1 created ; 20/04/17 completed ; 23/06/17
the outsiders → Random by 80s-aesthetic
112 parts Complete Mature
the outsiders preferences/ imagines I wrote this when I was 13 for your sake PLEASE DO NOT READ.
formal, F. GUTIERREZ ✓ by egotistics
44 parts Complete
{social media} created ; 09/09/17 completed ; 19/01/18
Magcon Boys Imagines & Preferences by becccccx
93 parts Complete
Hey everyone!! This is a collection of imagines/preferences I wrote MYSELF! I accept requests from anyone just no smut because like..... just not now lol! I will try to update as much as possible and everyday so I hope you enjoy! Just message me for a request! -Happy reading!! -Becca
Love Is Our Weapon *Sequal* by PierceVeilSirens1
15 parts Complete Mature
Sequel to "Get To You" Johlex fanfic (Reading first book would help before reading this one) *A few touchy subjects are mentioned throughout the book and no offence is meant* *Vry cringy*
IMESSAGES | NATE MALOLEY {COMPLETE} by sinnerbaby
94 parts Complete Mature
❝sorry, but i think u got the wrong number❞ copyrights towards ©sinnerbaby, 2016 highest rank: #28 in fanfiction
Shannon x Female Reader:Lesbian Story by TheAestheticGirl
10 parts Complete Mature
My friend Ava wanted me to do a fic about her and her 'wife' Shannon so I decided to be a grateful person and write it for her. But this could be for any girl. Just change Ava's name to yours and then BAM!! Your in the story! I DO NOT OWN MDE!! WARNING THIS CONTAINS:girlxgirl
timothée chalamet imagines by beauty200345
190 parts Complete Mature
Timothée Chalamet imagines 💗 !!REQUESTS ARE CLOSED!! * = smut, events leading to smut/events after smut, and mentions of mature content. I'm not a writer, but this is what I can do! Frequent updates at best :)
You may also like
Slide 1 of 10
Falling In Love ≫ c.a.d cover
𝐋𝐀𝐈𝐃𝐁𝐀𝐂𝐊, timothée chalamet cover
social, 13RW ✓ cover
the outsiders → Random cover
formal, F. GUTIERREZ ✓ cover
Magcon Boys Imagines & Preferences cover
Love Is Our Weapon *Sequal* cover
IMESSAGES | NATE MALOLEY {COMPLETE} cover
Shannon x Female Reader:Lesbian Story cover
timothée chalamet imagines cover

Falling In Love ≫ c.a.d

63 parts Complete

2 fans wanted to see their heros, but somethings go completely different and bad things happen. check it out to know more

More details