Kidnapped By MDE
LizzyTheW3ird0
  • Reads 873
  • Votes 52
  • Parts 22
  • Time 54m
  • Reads 873
  • Votes 52
  • Parts 22
  • Time 54m
LizzyTheW3ird0
Ongoing, First published Mar 31, 2016
Mature
alexdoramebryanstarsfanfictionheythereimshannonjeydonwalejohnnieguilbertjordansweetokyledavidballskyledavidhallkylehallmdemdefanficmydigitalescaperobbyepicsausesammrochelleshannontaylorshyleshylersoundslikeharmonytylerhagen
Mature audiences only. May contain subjects not appropriate for some audiences. Viewer discretion advised.
Public Domain
alexdoramebryanstarsfanfictionheythereimshannonjeydonwalejohnnieguilbertjordansweetokyledavidballskyledavidhallkylehallmdemdefanficmydigitalescaperobbyepicsausesammrochelleshannontaylorshyleshylersoundslikeharmonytylerhagen
Table of contents

22 parts

Sign up to add Kidnapped By MDE to your library and receive updates
or
Content Guidelines
You may also like
Magcon preferences/Imagines by explicitespinosaaa
108 parts Complete
Heyy this are just some magcon preferences and imagines BYEEE
Tik Tok Boy Imagines by fanficforyou1
35 parts Complete
You already know... ;)
Magcon imagines <3 by sleep_eat_write
17 parts Complete
Magcon imagines here! Jack G Jack J Matthew Cameron Aaron Shawn Sammy Yes I know this isn't all of them, please do not hate. {completed} * This was written many years ago when I was young so no judgement
My Digital Escape Preferences/ Imagines by DanceWithTheStars45
93 parts Complete
I love these, and I wanted to try it out. Thank you for reading! If you enjoyed it, please like the story or even add me to be up to date on changes.
𝘏π˜ͺ𝘴𝘡𝘰𝘳𝘺 || CHARLIE GILLESPIE βœ”οΈ by sarahdemedici
58 parts Complete
𝑰𝒕'𝒔 π’π’Šπ’Œπ’† π’˜π’† 𝒏𝒆𝒗𝒆𝒓 π’“π’†π’‚π’π’π’š 𝒆𝒗𝒆𝒓 𝒄𝒍𝒐𝒔𝒆𝒅 𝒕𝒉𝒂𝒕 𝒅𝒐𝒐𝒓.. 𝒀𝒆𝒂𝒉, π’˜π’† π’ˆπ’ π’˜π’‚π’š, π’˜π’‚π’š, π’˜π’‚π’š, π’˜π’‚π’š π’ƒπ’‚π’„π’Œ [κœ±α΄α΄„Ιͺα΄€ΚŸ ᴍᴇᴅΙͺα΄€ α΄€α΄œ]
Extremely Dirty Hannie by inyomamasbedroom
44 parts Complete Mature
Mature content don't read if under 13+
Magcon Imagines & Preferences by mesmerizeddd
163 parts Complete
Magcon Imagines & Preferences, all written by me. Hope you enjoy! x
Magcon Imagines by designate
71 parts Complete
Just imagines on the magcon boys and message me if you want one!
Instagram β‡’ Jack Gilinsky by SimplyJodi
106 parts Complete
@JackGilinsky followed you
Lost In Love (Sequel to "Crazy For U") by naomi14
21 parts Complete
Copyright Β© 2015 Naomi14, All Rights Reserved.
You may also like
Slide 1 of 10
Magcon preferences/Imagines cover
Tik Tok Boy Imagines cover
Magcon imagines <3 cover
My Digital Escape Preferences/ Imagines cover
𝘏π˜ͺ𝘴𝘡𝘰𝘳𝘺 || CHARLIE GILLESPIE βœ”οΈ cover
Extremely Dirty Hannie cover
Magcon Imagines & Preferences cover
Magcon Imagines cover
Instagram β‡’ Jack Gilinsky cover
Lost In Love (Sequel to "Crazy For U") cover

Magcon preferences/Imagines

108 parts Complete

Heyy this are just some magcon preferences and imagines BYEEE

More details