Story cover for Kidnapped By MDE by LizzyTheW3ird0
Kidnapped By MDE
LizzyTheW3ird0
  • WpView
    Reads 896
  • WpVote
    Votes 52
  • WpPart
    Parts 22
  • WpHistory
    Time 54m
  • WpView
    Reads 896
  • WpVote
    Votes 52
  • WpPart
    Parts 22
  • WpHistory
    Time 54m
LizzyTheW3ird0
Ongoing, First published Mar 31, 2016
Mature
alexdoramebryanstarsfanfictionheythereimshannonjeydonwalejohnnieguilbertjordansweetokyledavidballskyledavidhallkylehallmdemdefanficmydigitalescaperobbyepicsausesammrochelleshannontaylorshyleshylersoundslikeharmonytylerhagen
Mature audiences only. May contain subjects not appropriate for some audiences. Viewer discretion advised.
Public Domain
alexdoramebryanstarsfanfictionheythereimshannonjeydonwalejohnnieguilbertjordansweetokyledavidballskyledavidhallkylehallmdemdefanficmydigitalescaperobbyepicsausesammrochelleshannontaylorshyleshylersoundslikeharmonytylerhagen
Table of contents

22 parts

Sign up to add Kidnapped By MDE to your library and receive updates
or
Content Guidelines
You may also like
the outsiders → Random by 80s-aesthetic
112 parts Complete Mature
the outsiders preferences/ imagines I wrote this when I was 13 for your sake PLEASE DO NOT READ.
Shannon x Female Reader:Lesbian Story by TheAestheticGirl
10 parts Complete Mature
My friend Ava wanted me to do a fic about her and her 'wife' Shannon so I decided to be a grateful person and write it for her. But this could be for any girl. Just change Ava's name to yours and then BAM!! Your in the story! I DO NOT OWN MDE!! WARNING THIS CONTAINS:girlxgirl
Magcon preferences/Imagines by explicitespinosaaa
108 parts Complete
Heyy this are just some magcon preferences and imagines BYEEE
IMESSAGES | NATE MALOLEY {COMPLETE} by sinnerbaby
94 parts Complete Mature
❝sorry, but i think u got the wrong number❞ copyrights towards ©sinnerbaby, 2016 highest rank: #28 in fanfiction
Away with me (jordan sweeto) by ellaisnothereanymore
39 parts Complete
"I cant believe Jordan Sweeto just save my life"
Falling In Love ≫ c.a.d by lovablemendess
63 parts Complete
2 fans wanted to see their heros, but somethings go completely different and bad things happen. check it out to know more
timothée chalamet imagines by beauty200345
190 parts Complete Mature
Timothée Chalamet imagines 💗 !!REQUESTS ARE CLOSED!! * = smut, events leading to smut/events after smut, and mentions of mature content. I'm not a writer, but this is what I can do! Frequent updates at best :)
𝘏𝘪𝘴𝘵𝘰𝘳𝘺 || CHARLIE GILLESPIE ✔️ by sarahdemedici
58 parts Complete
𝑰𝒕'𝒔 𝒍𝒊𝒌𝒆 𝒘𝒆 𝒏𝒆𝒗𝒆𝒓 𝒓𝒆𝒂𝒍𝒍𝒚 𝒆𝒗𝒆𝒓 𝒄𝒍𝒐𝒔𝒆𝒅 𝒕𝒉𝒂𝒕 𝒅𝒐𝒐𝒓.. 𝒀𝒆𝒂𝒉, 𝒘𝒆 𝒈𝒐 𝒘𝒂𝒚, 𝒘𝒂𝒚, 𝒘𝒂𝒚, 𝒘𝒂𝒚 𝒃𝒂𝒄𝒌 [ꜱᴏᴄɪᴀʟ ᴍᴇᴅɪᴀ ᴀᴜ]
social, 13RW ✓ by egotistics
42 parts Complete Mature
{13rw social media fic} part 1 created ; 20/04/17 completed ; 23/06/17
ITS ABOUT TIME ➤ Ponyboy Curtis by Treesthatfly
28 parts Complete Mature
❝ 𝘐𝘵'𝘴 𝘢𝘣𝘰𝘶𝘵 𝘵𝘪𝘮𝘦 𝘺𝘰𝘶 𝘵𝘸𝘰 𝘨𝘰𝘵 𝘵𝘰𝘨𝘦𝘵𝘩𝘦𝘳. ❞
You may also like
Slide 1 of 10
the outsiders → Random cover
Shannon x Female Reader:Lesbian Story cover
Magcon preferences/Imagines cover
IMESSAGES | NATE MALOLEY {COMPLETE} cover
Away with me (jordan sweeto) cover
Falling In Love ≫ c.a.d cover
timothée chalamet imagines cover
𝘏𝘪𝘴𝘵𝘰𝘳𝘺 || CHARLIE GILLESPIE ✔️ cover
social, 13RW ✓ cover
ITS ABOUT TIME ➤ Ponyboy Curtis cover

the outsiders → Random

112 parts Complete Mature

the outsiders preferences/ imagines I wrote this when I was 13 for your sake PLEASE DO NOT READ.

More details