Yesterday's Prince
hlynn117
  • Reads 70,909
  • Votes 4,743
  • Parts 41
  • Time 7h 53m
  • Reads 70,909
  • Votes 4,743
  • Parts 41
  • Time 7h 53m
hlynn117
Ongoing, First published Apr 08, 2016
adventurebodyswapcurseepicfairytalefairytaleretellingfantasyfcras2016herohighfantasykingkingdommagicmedievalmerlinmythprincespellthefaefolkwattys2016
What would you do if your body and your kingdom were stolen?
  
  [A FEATURED STORY]
    
  Uther is a young prince who's reluctantly thrust into having to defend his throne against his usurping uncle and all-around powerful wizard, who uses his powers to steal the one thing Uther thought he couldn't take: his own body. After becoming the villain of the realm in an instant, Uther struggles to find anyone that will believe his story. His uncle's unsavory reputation lands him with a family of dark fae, a goblin, and a troll--not the usual team of knightly heroes.
    
  Together, this odd team will untangle a web of curses, escape bounty hunters, and confront fae. If Uther can't figure out how to reverse his uncle's curse, he'll be trapped in a body that's not his own--doomed to be a villain--for the rest of his life.
    
  YESTERDAY'S PRINCE is The Sword in the Stone with a Freaky Friday twist. Now entered in #Wattys2016
All Rights Reserved
adventurebodyswapcurseepicfairytalefairytaleretellingfantasyfcras2016herohighfantasykingkingdommagicmedievalmerlinmythprincespellthefaefolkwattys2016
Table of contents

41 parts

Sign up to add Yesterday's Prince to your library and receive updates
or
#152spell
Content Guidelines
You may also like
Her Knight in Camelot by MarieHiggins
25 parts Complete
A modern-day man's ordinary life shatters when a fierce, enigmatic woman bursts into his world, claiming to hail from the medieval era. Her mission? To drag him back through time to the legendary kingdom of Camelot. The only problem-he doesn't believe in magic, knights, or anything she's saying. But the past won't take "no" for an answer. Camelot is on the brink of ruin. The king is dead, the realm is in chaos, and the rightful heir-spirited away to the future by ancient magic-has been lost to time. Desperate to save the kingdom, Merlin's inexperienced granddaughter is assigned the task of retrieving the true king. She journeys to the modern world, armed with little more than a handful of spells and a fierce determination. But the future is far stranger than she imagined, and the lost Arthur-now an ordinary man-has no memory of his royal destiny. To make matters worse, she's misplaced the one magical artifact capable of returning them to Camelot. Time is running out, and the fate of the legendary kingdom hangs by a thread.
Crescent | ✓ by TheConfusedTurtle
43 parts Complete
For the fae, magic is everything: status, power, wealth, honor. For Vera Reite, a fae born with no magic, it is a shameful reminder that she will never amount to anything. Whispers of a fae-killing monster begin to circulate the Moon Court. It lurks in the woods, feeding off the mana of its victims. Those that go missing and find themselves at the mercy of the beast are never seen or heard from again. Fear quickly takes hold of the fae court; it's only a matter of time before their whole world is destroyed by this creature. However, it offers Vera a glimmer of hope. When she learns of it, she ventures into the wood to kill the beast, believing that she will be able to absorb the magic it has stolen. But the woods are as dangerous as the beast, and Vera soon finds herself lost. In a stroke of luck, she comes across an old manor deep in the forest where a strange boy is sealed away. If Vera wishes to slay the beast, she will first have to uncover the secret of the manor and its prisoner before it's too late. 𝐀 𝐟𝐚𝐞 𝐰𝐢𝐭𝐡𝐨𝐮𝐭 𝐦𝐚𝐠𝐢𝐜. 𝐀 𝐩𝐫𝐢𝐬𝐨𝐧𝐞𝐫 𝐰𝐢𝐭𝐡 𝐚 𝐝𝐞𝐚𝐝𝐥𝐲 𝐬𝐞𝐜𝐫𝐞𝐭. 𝐓𝐨𝐠𝐞𝐭𝐡𝐞𝐫, 𝐭𝐡𝐞𝐲 𝐦𝐚𝐲 𝐛𝐞 𝐚𝐛𝐥𝐞 𝐭𝐨 𝐬𝐚𝐯𝐞 𝐭𝐡𝐞 𝐟𝐚𝐞 𝐰𝐨𝐫𝐥𝐝 𝐛𝐞𝐟𝐨𝐫𝐞 𝐢𝐭 𝐢𝐬 𝐝𝐞𝐬𝐭𝐫𝐨𝐲𝐞𝐝. ||Completed: 8/15/24 Word count: 90,000 - 100,000||
Kingdom of Blood and Dreams: A Tale of Magic and Destiny in King Arthur's Court by rubyvalladares
21 parts Ongoing Mature
What if Merlin was a girl, hiding as a boy, and falling in love with King Arthur? Displaced from my village, hunted by the king, a woman without a place, I do the only thing I know to do: use magic to conceal my identity. That one choice leads me to the home of King Uther, where he makes me the servant of his son, Prince Arthur. Only Arthur doesn't know I'm a woman. He sees a boy. A servant. A fighter. And he makes me his personal assassin.
Her Cinder Throne (Completed) by ViridianHues
105 parts Complete
Cole Glassad couldn't care less about the upcoming palace ball meant to find a wife for the prince. Her life is down in the dangerous Sparkstone mines, slaving away for a few coins that her stepmother and stepsister promptly steal. With life a living hell, she has barely enough energy to care for the injured animals she tends in secret, much less a party for the royal family that cares so little for her and the people like her. It isn't until a mysterious man appears out of the shadows, claiming to be one of the long-lost faeries and offering her a chance at freedom, that she begins to see hope. In exchange for enough money to free herself from her family, the faerie asks only for one thing in return-- that Cole attends the ball in order to get close enough to the prince to assassinate him and bring an end to the corrupted royal line. With her mission clear, Cole enters the world of the palace to learn about the prince and find a way into his ball. But dark secrets, violent plots, a strange sense that perhaps the prince isn't as bad as the faerie makes him seem, and a life-changing discovery about her past, all conspire to make Cole's shot at freedom messy and difficult. She must find the strength to get close to the prince, or else the mysterious faerie will send her back to the mines and her dreadful family. Once the clock strikes midnight... she must fulfill her end of the bargain. Once the clock strikes midnight... her hands must be red with the prince's blood.
The Great Camelot by Rhomel0699
20 parts Ongoing
In the kingdom of Camelot, a young and noble king named Uther rules with a heart full of devotion for his land and its people. His reign is defined by fairness, compassion, and an unyielding commitment to justice. Uther dreams of creating a golden age for Camelot, a realm where prosperity, unity, and peace flourish under his care. Loved by his subjects, he is a beacon of hope and strength for all who live within the kingdom's borders. But fate is not as kind as Uther's intentions. A dark prophecy emerges, foretelling the downfall of Camelot and the tragic demise of its beloved king. Though Uther fights valiantly to protect his kingdom, misfortunes begin to plague the land. Crops wither, alliances fracture, and a shadow of despair creeps over Camelot. No matter how hard he tries, every decision he makes seems to draw him closer to the destiny he so desperately wishes to avoid. Determined to defy fate, Uther embarks on a perilous quest to uncover the truth behind the prophecy. Guided by the wisdom of Seraphine, the kingdom's Most powerful sorcerer, Uther ventures into the heart of ancient magic and forgotten legends. Alongside loyal companions he confronts trials that test his courage, his heart, and his resolve. As Uther battles forces greater than himself, he learns that changing destiny may require unimaginable sacrifices. Will his unwavering love for Camelot and its people be enough to rewrite his fate, or is his kingdom doomed to fall? This is a tale of bravery, love, and the relentless struggle against an unkind fate, where a king must choose between protecting the one he Loves or the kingdom he holds dear.
The Faerie Curses by August_Blue
55 parts Complete
A war is brewing in The Faerie Realm; it's up to a knight, a prince, and an outcast to stop it. When a sinister and mysterious master takes control of a group of cursed faeries known as the sprites, they want revenge against the fae...and they will stop at nothing to obliterate the kingdoms known as the Faerie Courts in a slaughtering attack on Midsummer's night. When Marissa, a Winter Knight with a dark past, joins forces with the arrogant prince Glen and the runaway sprite Diandre, she knows that they are the fae's only chance of defeating The Master. The first step? Become fugitives. These three will have to race against time to recover the Objects of Power: a wand and a scepter that have been lost for centuries. But to prevent a dark war, Marissa, Glen, and Diandre will be tested like they've never imagined. And it might just cost them their lives. [Completed] Highest Ranking: #724 in Fantasy ALL RIGHTS RESERVED
Roses and Thorns by Nithiel2001
25 parts Complete
Ivelle Preston had a perfectly normal life. She grew up in small English town, and she always wished she had a more adventurous life. Her wish came true when she moved to London. Her life changed in a few month. Someone killed her mother, but the police says it was just a robbery. In her last letter her mother asked her to find one of her old friends Margareth Lloyd. After the letter Ivelle finds herself in a whole new world, surrounded by magical creatures, and in the middle of an upcoming war. Will she be able to save, the world she barely know, or will the evil win? ~ "You are possibly the worst apprentice I've ever trained." laughed the man. "Thank you, for the encouragement. " she rolled her eyes and lifted her sword. "Let's get back to work." "That's the spirit!" the man drew out his sword "Ready?" "Ready like hell." ~ Best rankings: #11 in Fantasy creatures (2022. 03. 06.)
Dark Merlin: The Man Called Emrys by Camelot101
21 parts Complete
What would you do if you were trapped inside your mind? That every time you slept, the beast came out to terrorize the people you loved. After escaping Morgana's never ending torture, a series of killings breaks out in Camelot. At first, the only victims are servants, but Uther's fear leads him to believe the attacks are magical and will soon result in the death of his son. Trying to hide his trauma, Merlin will stop at nothing to ensure the safety of Camelot, but as the killing continues, he will soon learn that he is behind them only he has no memory of ever attacking. Going by the name Emrys, Merlin's double half has teamed up with his lover Morgana, and as a war brews between the sorcerers and the Pendragon's, Emrys is working as an inside man under Merlin's cover, killing off anyone who stands in his way. As he fulfills his role with Morgana in seeking Camelot's destruction, his destiny edges closer, and the prophecy of him being Prince Arthur's bane is nigh. After the death of Uther and his son, Emrys and Morgana will be able to claim the throne for themselves and welcome in a new era. One where magic is welcomed. After discovering he has a dark half, Merlin sets out to find a way to stop the upcoming war and free himself from his inner monster, but the way doesn't seem easy. With the help of a letter from his father, he must learn to overcome Emrys before Emrys takes full control. Disclaimer: I do not own anything from Merlin ----------------- #1 in DarkMerlin in June of 2023
Beautiful Beast by lucyanneholland
35 parts Complete
My name is Kalista. They call me the beast. Kalista has been cursed by a powerful sorceress and is now a prisoner in her own palace. As petals fall from an enchanted rose, her fate and the sorceress's victory draw nearer. But Kalista refuses to be defeated so easily and uses her own magic to push against the bindings. Yet what if it is not enough and the only way the curse might be shattered is through the help of another? When Arawn crosses into the beast's domain, he has one motive: revenge for his brother's death. But as he draws nearer to the beast and is surrounded by invisible servants, magical banquets, and an enchanted forest, he realizes that this beast is much more complex and much more human than he first thought. As their paths intertwine, Kalista must risk opening her heart to another, while Arawn must learn to see past his hate and prejudice. Together, they struggle against spells, wolves, and time itself to break the curse. If they fail, Kalista will fall asleep and will never again wake.
Immortality Is A Curse by RandWindhusk
42 parts Ongoing Mature
What happens when you and your spouse are given immortality? Do you have a happily ever after that lasts an eternity or does a war break out between the two of you that lasts for an eternity? Love may conquer all, but war changes all. What is love without a loved one? How long can you really be with someone before everything they do starts to really irritate you? Also no one can know outside of the family. How long can you keep your reincarnation a secret? A different face but same personality.
You may also like
Slide 1 of 10
Her Knight in Camelot cover
Crescent | ✓ cover
Kingdom of Blood and Dreams: A Tale of Magic and Destiny in King Arthur's Court cover
Her Cinder Throne (Completed) cover
The Great Camelot cover
The Faerie Curses cover
Roses and Thorns cover
Dark Merlin: The Man Called Emrys cover
Beautiful Beast cover
Immortality Is A Curse cover

Her Knight in Camelot

25 parts Complete

A modern-day man's ordinary life shatters when a fierce, enigmatic woman bursts into his world, claiming to hail from the medieval era. Her mission? To drag him back through time to the legendary kingdom of Camelot. The only problem-he doesn't believe in magic, knights, or anything she's saying. But the past won't take "no" for an answer. Camelot is on the brink of ruin. The king is dead, the realm is in chaos, and the rightful heir-spirited away to the future by ancient magic-has been lost to time. Desperate to save the kingdom, Merlin's inexperienced granddaughter is assigned the task of retrieving the true king. She journeys to the modern world, armed with little more than a handful of spells and a fierce determination. But the future is far stranger than she imagined, and the lost Arthur-now an ordinary man-has no memory of his royal destiny. To make matters worse, she's misplaced the one magical artifact capable of returning them to Camelot. Time is running out, and the fate of the legendary kingdom hangs by a thread.

More details