The legend of the Lady in the Sand.
smurple4ever
  • Reads 54
  • Votes 5
  • Parts 1
  • Time 11m
  • Reads 54
  • Votes 5
  • Parts 1
  • Time 11m
smurple4ever
Ongoing, First published Jul 14, 2013
authorbestegyptianevilfriendslegendlikemoralreadstorysummerteenwitchwitches
A short story based on a legend of a young handsome man who comes across a beautiful woman who's stuck in a deserted desert; a woman bonded by magic to spend eternity bonded to a magical chain. Evil can disguise itself in many ways and if you look in the face of evil; evil's going to look right back at you.
All Rights Reserved
authorbestegyptianevilfriendslegendlikemoralreadstorysummerteenwitchwitches
Table of contents

1 part

Sign up to add The legend of the Lady in the Sand. to your library and receive updates
or
#797legend
Content Guidelines
You may also like
Approach With Caution by ShySimms11
6 parts Complete
A daughter that cannot die. The brother, sister and man in black. A maiden and a magic circle. The wish that goes too far. And a love that is not what it seems. Come hither and experience a collection of short stories to astound and unnerve you.
AT LAST - WHO ARE YOU? by VarshiniM4
23 parts Complete
The story plot flows around the life of a 18 year old teen who is moving from her hometown to another city for her higher studies in uni ....... also the unsolved mysteries from her past continues to follow her .
Atem x ReaderCurator or Queen? by SnowflakeDragon18
14 parts Complete
How long would you wait for your soul mate? After the death of his beloved Queen in childbirth, the beloved Pharaoh Atem swears to find her one day and return her to his side for eternity. 5000 years later, a curator begins to have strange visions and dreams as an extremely handsome ghost begins seducing her and beckoning her to come with him to a different world. Reader insert. I own nothing. Also slight yandere-ish behavior here and there
Beauty and the Pharaoh by luckycharms
67 parts Complete
May Khan's life was always pretty normal, but with final exams, prom and graduation looming around the corner, she didn't care much for anything except for getting out of high school. On her eighteenth birthday, however, her entire life changes. After finding a mysterious man claiming to be the Pharaoh of Egypt, a strange vision and her aunt's teachings force her to help him. Pharaoh Akhenatem had ruled Egypt with a stone heart and an iron fist. And when his cruelty gets out of hand, a red-eyed wizard curses him and sends him thousands of years into the future to a world where ignorance, arrogance and selfishness rules. But of all the places he could have landed, he ends up finding his way into the life of May. With the help of May's kind and selfless nature, an unexpected love finds the both of them as May comes to realize that evil is not as simple of a concept as it seems and that everyone has their own story. [Self-Published!!!]
Entombed in His Desire by HeidiFedor
39 parts Complete Mature
Amanda Addington has lived a sheltered existence while growing up in a sleepy little town in upstate New York. Because of her studious attitude at school, she has little time for boys. But even if she did find the time to date, it's difficult to meet any guys since she's attended a prestigious all girls private school most of her life. As Amanda's senior year begins, she is excited about growing up and is looking forward to her eighteenth birthday. However, she has a few minor problems that most girls her age don't seem to have to deal with. Like her Uncle Robert being headmaster at her school. Not only is he the most eligible bachelor in town. But Amanda has to witness her friends and classmates crushing on him everyday. Then there is the thorn in her side, her english teacher, Karen Crenshaw. She despises Amanda for being the niece of Robert Addington. The headmaster's position is a job that Karen craves, and has no qualms about taking her anger out on Amanda. But things start to change after a new teacher of Ancient History is hired; a gorgeous man by the name of Mark Jacobson. Soon everyone's attention shifts from Robert to Mark, and even Amanda is smitten with the new handsome man in town. She is more than delighted when he asks her to help him with his research; a book he's writing about ancient Egyptian beliefs and mythologies. But strange things begin to happen. Amanda starts having erotic dreams about being seduced by a panther type creature. And although not a furry, she is in no hurry to have the dreams discontinue. Soon everyday people begin to change, and even the nastiest person in town soon becomes the most pleasant. Odd dreams that seem like memories from the past plague Amanda almost every night, and she finds it hard to trust anyone anymore. For an ancient Egyptian deity has set his sights on her. And if she is not careful, she may find herself forever Entombed in His Desire.
Beautiful Beast by lucyanneholland
35 parts Complete
My name is Kalista. They call me the beast. Kalista has been cursed by a powerful sorceress and is now a prisoner in her own palace. As petals fall from an enchanted rose, her fate and the sorceress's victory draw nearer. But Kalista refuses to be defeated so easily and uses her own magic to push against the bindings. Yet what if it is not enough and the only way the curse might be shattered is through the help of another? When Arawn crosses into the beast's domain, he has one motive: revenge for his brother's death. But as he draws nearer to the beast and is surrounded by invisible servants, magical banquets, and an enchanted forest, he realizes that this beast is much more complex and much more human than he first thought. As their paths intertwine, Kalista must risk opening her heart to another, while Arawn must learn to see past his hate and prejudice. Together, they struggle against spells, wolves, and time itself to break the curse. If they fail, Kalista will fall asleep and will never again wake.
Age of Corruption by Harshi595
18 parts Complete
The story begins with a Greek demigod of the sun, tasked to find the source of the natural disasters in Egypt. He meets demigods from other parts of the world, but none of them could have expected what would take place. This book contains some violence and isn't for people who are looking for happy stories.
Rell and The Rose by hjnelson
60 parts Complete
A Beast stalks the night... but Beauty hunts him. A reimagining of the story you thought you knew. Rell grew up hearing stories of the Human Realm, a fantastic world with light at the flick of a finger, metal boxes that fly through the sky; a fantastic, faraway fairytale that she knows is too good to be true. Because Rell lives in the Dark Realm: a world full of magical creatures and a low-hanging sky, all protected by The Blood Rose. Until the day the Blood Rose is stolen away and taken to the Human Realm. Without it, the two realms will meet with disastrous consequences, the human sun bleaching all the magic from the Dark Realm. And so Rell leaves everything she knows to bring it back. There's only one problem: the Human Realm- especially high school- is nothing like the stories. There's some sort of code with words like "twerking" and "Instagram" she can't understand, and then there's Bastien, the boy who hates Rell for reasons she can't explain. But when Rell realizes Bastien is keeping just as many secrets as she is, the two become an unlikely team in the search for the Blood Rose. Time is ticking, and more than just The Dark Realm is at stake. Whoever stole the rose is now cursed to turn into a Beast every full moon, and is hidden among them. Students are going missing, and dark creatures are slipping into the Human Realm. Rell needs to find the Blood Rose, slay the Beast, survive high school, and sort out these new, confusing feelings for Bastien--all before the night of the full moon. To fail could mean the end of The Dark Realm and every magical creature within, but to succeed means she'll lose the boy she's falling for, and a Realm more beautiful than she ever imagined. A modern-day reimaging of Beauty and the Beast.
Accidentally yours by Huda_army2004
37 parts Ongoing
Accidentally Yours "I hate you." "Good. That makes two of us, wifey." Annie Khan and Fakhir Ahmed have never been friends. She's arrogant, independent, and impossible. He's a nerdy, soft-hearted bookworm who can't stand her attitude. Their arguments at college are legendary. But when their fathers force them into marriage, their world turns upside down. Annie refuses to be tied down, and Fakhir wants nothing to do with a spoiled brat. There's only one problem-divorce is not an option. Stuck in a marriage they never wanted, secrets from Annie's past threaten to break her. And the last person she expects to help her heal... is the one she claims to hate the most. Enemies by fate. Lovers by accident. Will they survive this forced marriage, or will they destroy each other first?
A Witch's World by NaniBoo123
16 parts Complete
This is a story about a teenage witch who is dealing with the hectic life of being a teenager and hiding her secret. But even though witches are practically extinct there are still a few out there along with other mystical creatures. What will happen when Anaysia learns something huge about her boyfriend? Will Anaysia and her worst enemy have more in common than they think? Well, you'll just have to read and find out. 
You may also like
Slide 1 of 10
Approach With Caution cover
AT LAST - WHO ARE YOU? cover
Atem x ReaderCurator or Queen? cover
Beauty and the Pharaoh cover
Entombed in His Desire cover
Beautiful Beast cover
Age of Corruption cover
Rell and The Rose cover
Accidentally yours cover
A Witch's World cover

Approach With Caution

6 parts Complete

A daughter that cannot die. The brother, sister and man in black. A maiden and a magic circle. The wish that goes too far. And a love that is not what it seems. Come hither and experience a collection of short stories to astound and unnerve you.

More details