- Reads 61,613
- Votes 649
- Parts 36
- Time 1h 33m
Ongoing, First published May 18, 2011
2010abbyabdabdcontestabuseactionactorsactressesadventureafterafterbreakingdawnalexandriaalienamberambernicolecullenambernicoleeanastasiaanastasiasannekewenzelanswersanty-bullyattitudeawardsbabybellabigbiosblackbloodblowsboybreakingbullybullyingcassiechapterchapter1chapter19chapter2characterclancycontestcontinuationcrescentcullendaddarkdawndeathdelcandescribedesiresdylanedwardemotionerectionfamilyfamousfanfanfictionfantasyfaqfayefeministfictionfloridageneresgirlhaitihavinghelphelpinghandhighschoolhockeyhorrorhothumoriceinfromationinquiryinspirationinspirationalinspireinspiringisabeljacobjerkkeyskidletterslikelovematthewmeyermissmoonmovemysterynamednewnhlnicolenon-fictionomorifiápainpeaceperfectpoempoetrypoetrycontestquestionsreadrealrecommendationsrenemseerestriprollinromancerunawaysadsagascaryschoolsequelsexualsexyshallowshortshotshout-outssicksinglesportsportsstepheniestoriesstorystudentsuspenseswansweettattoteaserteenteensthoughtsthrillertrueturnedtwilighttypicalunprotectedvampirewantwattywattyawardwhenwindyoungyoure
Public Domain
2010abbyabdabdcontestabuseactionactorsactressesadventureafterafterbreakingdawnalexandriaalienamberambernicolecullenambernicoleeanastasiaanastasiasannekewenzelanswersanty-bullyattitudeawardsbabybellabigbiosblackbloodblowsboybreakingbullybullyingcassiechapterchapter1chapter19chapter2characterclancycontestcontinuationcrescentcullendaddarkdawndeathdelcandescribedesiresdylanedwardemotionerectionfamilyfamousfanfanfictionfantasyfaqfayefeministfictionfloridageneresgirlhaitihavinghelphelpinghandhighschoolhockeyhorrorhothumoriceinfromationinquiryinspirationinspirationalinspireinspiringisabeljacobjerkkeyskidletterslikelovematthewmeyermissmoonmovemysterynamednewnhlnicolenon-fictionomorifiápainpeaceperfectpoempoetrypoetrycontestquestionsreadrealrecommendationsrenemseerestriprollinromancerunawaysadsagascaryschoolsequelsexualsexyshallowshortshotshout-outssicksinglesportsportsstepheniestoriesstorystudentsuspenseswansweettattoteaserteenteensthoughtsthrillertrueturnedtwilighttypicalunprotectedvampirewantwattywattyawardwhenwindyoungyoure
Table of contents
- Contest 'AfterBreakingDawn'Tue, Feb 2, 2010
- Mini Character Bio's as of CH12 AfterBreakingDawnThu, Feb 4, 2010
- What do teens want to read? With a update.Sat, Feb 6, 2010
- Future Projects, Info on Present!Thu, Feb 11, 2010
- Whos Head Do You Want To Get Into? (Twilight: ABD)Fri, Feb 19, 2010
- After Breaking Dawn: The SequelTue, Mar 2, 2010
- Read this, you won't regret it if you love a good story!Mon, Mar 8, 2010
- Chapter 18 Teaser 1: After Breaking DawnMon, Mar 15, 2010
- Chapter 19 Teaser 1: After Breaking DawnThu, Mar 18, 2010
- The Sequel After Breaking Dawn: Crescent Moon Teaser 1Sun, Mar 21, 2010
- After Breaking Dawn Chapter 22 Teaser: 1Fri, Mar 26, 2010
- Chapter 23 Teaser 1: After Breaking DawnSat, Apr 3, 2010
- Chapter 23 Teaser 2: After Breaking DawnSun, Apr 4, 2010
- Chapter 24 Teaser 1: After Breaking DawnWed, Apr 7, 2010
- Chapter 25 Teaser 1: After Breaking DawnSun, Apr 11, 2010
- Have any questions, recommendations, or thoughts?Tue, Sep 14, 2010
- Preface - Rollin' Like a Big ShotSun, Jun 13, 2010
- Info and castSat, Jun 12, 2010
- The Hot New Kid With An Attitude And Miss Perfect; Is It Love? 2Sun, Mar 21, 2010
- The Hot New Kid With An Attitude And Miss Perfect; Is It Love? 1Sun, Mar 21, 2010
- Single Dad: Having Anastasia's BabyFri, Mar 19, 2010
- A Runaway Named Cassie: Chapter 1Sat, Mar 6, 2010
- It Was My Life; Now Its His Sick Desires [1]Tue, Feb 16, 2010
- It Was My Life; Now Its His Sick Desires [2]Wed, Feb 17, 2010
- Rest In Peace, Abby. [Poem.]Wed, Apr 21, 2010
- You're Shallow [Poem]Thu, Apr 8, 2010
- Family [Poem]Wed, Apr 7, 2010
- How do I describe love [Poem]Wed, Apr 7, 2010
- These Keys [Poem]Wed, Apr 7, 2010
- When The Wind Blows [Poem]Wed, Apr 7, 2010
- Continue "After Breaking Dawn" or start over new?Tue, Dec 27, 2011
- Against All Odds: PrologueTue, Oct 4, 2011
- Against All Odds: Chapter 1Tue, Oct 4, 2011
- Against All Odds: Chapter 2Tue, Dec 27, 2011
- Prologue: So̱tí̱ras mas, Emma. (Our Saviour, Emma)Tue, Apr 17, 2012
- After Breaking Dawn: Name GameMon, May 14, 2012
Sign up to add Teasers, Info, Short Stories, Poems, Etc. to your library and receive updates
or
You may also like
