Vladimir Dracula
LokiThorodinson4king
  • Reads 924
  • Votes 14
  • Parts 11
  • Time 47m
  • Reads 924
  • Votes 14
  • Parts 11
  • Time 47m
LokiThorodinson4king
Ongoing, First published May 22, 2016
draculafantasymysteryteenvampirevladimir
Vladimir was the only male of the direct Dracula line. Not the only child, just the only male. There was Ingrid, Vladimir's older sister. Now, Vladimir has to try to blend in with his classmates, and really everyone in the school Vladimir's father had decided to buy and run. The question was not if he had to buy if her could, even when it came down to it. Our would the truth about his being a Vampire-born vampire come out?
Public Domain
draculafantasymysteryteenvampirevladimir
Table of contents

11 parts

Sign up to add Vladimir Dracula to your library and receive updates
or
#55vladimir
Content Guidelines
You may also like
Adopted By The Vampire Prince by LocalTwink
45 parts Complete
When a young girl, who has been in an orphanage most of her life, finally gets adopted, she is the happiest she could ever be. Camille Dagger, a 16 year old, misunderstood girl soon gets a life like no other. Camille soon comes to the conclusion that she is quickly falling head over heals for her adoptive brother, Alexander Night, a very handsome, tall, black haired boy. Once she confronts him, he also confesses something dire. Alexander tells her that him, along with his whole family and friends that also live in the house, are vampires. After some confusing information she then had gotten from everyone, she soon finds a major secret out about herself as well. Once word gets out that Camille is finally free, and out on her own, some dangerous and unwanted ears hear of it. James, a werewolf vampire hybrid, soon comes after Camille and her now found family. From there on, things got very tricky for everyone.
The Lost Countess (Book 1) (Count Dracula fanfic) by iggy102
21 parts Complete Mature
The Count has nearly everything: a giant castle, a son, and relative fear of the masses. However, he lost one key aspect 5 years ago. His precious countess was the only woman he truly loved. Will fate bring them back or keep them apart forever? (follows series 1 of the BBC show Young Dracula)
A vampires Mistress by Love_Story27
23 parts Complete Mature
"We can't do this" He took another step towards me "Your mouth says no but your eyes say yes" He brushed his fingers lightly across my lips. I don't know how it happened or who moved first but suddenly my lips were on his and I was kissing him like my life depended on it Lucy's life has been devastating ever since her parents were murdered. Exciting in the world but not living life. On the night of her parents 5 year anniversary she meets Vladimir. A vampire. She wants nothing to do with him but that changes when he has a proposition for her. Come and work for him in his family run business. She really needs the cash so she takes him up on his offer. Not fully knowing what she's really gotten her self into. Her life is suddenly full of Betrayals, heartbreaks, lies and love.
Forced by DarkRemorse
17 parts Complete
Inspired by cold_lady19's He's my master, I belong to him. Vladimir is a vampire prince with everything he could want in his life. The only thing he doesn't want is his sister...oh and the new slave he's being forced to get. She's not like any normal human Vlad has interacted with before-she won't scream and run away from him. Can Prince Vladimir of Marona deal with her strong nature? Or will she just end up being another blood supply? Status: complete and awaiting sequel, Control
Legacies of the Night. Part 1: Remembrance by Azrael19872
20 parts Complete Mature
Awakening with a nearly blank slate, Vladimir Medvedev, a vampire of noble lineage, embarks on a perilous journey to reclaim his past. Driven by a thirst for both truth and blood, he unravels forgotten memories, confronts those who betrayed him, and navigates the treacherous currents of a vampire civil war. Bound by duty to his throne and his people, he must forge alliances, old and new, to prevent the annihilation of his kind and humanity itself.
My First True Love {Completed} by twilightgirl1
35 parts Complete
{{Believe in the unimaginable when it comes to love.}} Jane was just an ordinary girl when one day everything came crushing down her life. She lost her father at a very young age and had to see her mother remarry another man. But just when she thought things were going to be fine, a new family moves in right next door. She is not only intrigued about this new family, but what caught her attention was their son; Alexander. It all seemed like a dream to her when he first call her name and when he was the first one to be there for her whenever she felt sad. For once, Jane felt like she could trust anyone without feeling sad, but she couldn’t help but to feel that there was something else that Alexander was keeping from her. Will she ever trust him again after she finds out his true identity? Or when he tells her that he is in love with her?
The Heart Of A Vampire by akxnnsns
95 parts Ongoing
This story follows 19 year old Evangeline DeCarmille, the daughter of a French nobleman who is far too outspoken for her fathers liking and has been sent to live a humble life in the Romanian countryside for 2 years to get her out of the public eye and save her families image after she made a few bold lcomments during a toast at the kings annual ball, in front of everybody. She now lives in the Romanian countryside, and just so happens to have caught the eye of a certain vampire.
Descendants Son of Dracula by Meloetta246
18 parts Complete
A Disney Descendants and Dracula crossover story. When the Core Four come to Auradon everyone is curious about the new exchange students, but none more so than Vlad Alucard. Vlad Alucard is Auradon Prep's only vampire student and little is known about his family or origins. Normally a loner, Vlad has taken an interest in the new Isle students, particularly a certain purple haired beauty. Controlling his urge to drink human blood is hard enough when surrounded by students at school, how will he control it when he starts to fall in love?
π–‚π–—π–Žπ–™π–™π–Šπ–“ 𝕴𝖓 π•Ύπ–ˆπ–—π–Žπ–•π–™π–šπ–—π–Šπ–˜ | 𝔻𝕣𝕒𝕔𝕦𝕝𝕒 by YourWrittenNarrator
29 parts Complete Mature
Count Dracula x Female Reader In a captivating tale of dark enchantment and forbidden love, we meet Y/n, the daughter of a respected high priest. Little did she know that her life would soon take an unexpected turn. When a mysterious man named Vladimir Drakul sought shelter in their humble abode, they welcomed him with open arms, oblivious to his true identity Count Dracula. As the days passed, an unusual bond began to form between Y/n and the enigmatic stranger. However, this newfound affection would soon become a dangerous threat, as Count Dracula revealed his sinister intentions, v Y/n's beloved parents, unless she accompanies him to the mysterious land of Transylvania
Dracula Retold by LintaAM
16 parts Ongoing
From the shadows, someone has been the silent guardian for the House of Dracula. That someone is the one who created the legend, who made a deal with the devil to protect his son. But Vlad the III, also known as Dracula, had won the ability to protect his son's sons. So when a new threat arises and his great-times something-grandson is in danger, it is time for Dracula to step out of the shadows as a new legend is born. #2 in luke Evans!! 11/18 #1 in mirena 08/19 Thanks to you all, even though I haven't been updating very often. School, work and therapy keeps me busy but school is ending soon!
You may also like
Slide 1 of 10
Adopted By The Vampire Prince cover
The Lost Countess (Book 1) (Count Dracula fanfic) cover
A vampires Mistress cover
Forced cover
Legacies of the Night. Part 1: Remembrance cover
My First True Love {Completed} cover
The Heart Of A Vampire cover
Descendants Son of Dracula cover
π–‚π–—π–Žπ–™π–™π–Šπ–“ 𝕴𝖓 π•Ύπ–ˆπ–—π–Žπ–•π–™π–šπ–—π–Šπ–˜ | 𝔻𝕣𝕒𝕔𝕦𝕝𝕒 cover
Dracula Retold cover

Adopted By The Vampire Prince

45 parts Complete

When a young girl, who has been in an orphanage most of her life, finally gets adopted, she is the happiest she could ever be. Camille Dagger, a 16 year old, misunderstood girl soon gets a life like no other. Camille soon comes to the conclusion that she is quickly falling head over heals for her adoptive brother, Alexander Night, a very handsome, tall, black haired boy. Once she confronts him, he also confesses something dire. Alexander tells her that him, along with his whole family and friends that also live in the house, are vampires. After some confusing information she then had gotten from everyone, she soon finds a major secret out about herself as well. Once word gets out that Camille is finally free, and out on her own, some dangerous and unwanted ears hear of it. James, a werewolf vampire hybrid, soon comes after Camille and her now found family. From there on, things got very tricky for everyone.

More details