CloTi Story
friendly_blueberry
  • Reads 11,233
  • Votes 157
  • Parts 9
  • Time 1h 1m
  • Reads 11,233
  • Votes 157
  • Parts 9
  • Time 1h 1m
friendly_blueberry
Complete, First published Jun 02, 2016
Mature
cloudstrifecompfinalfantasyfinalfantasyviitifalockhart
Pairing: Cloud and Tifa (CloTi)
       Genre: Romance
Disclaimer: I OWN NOTHING! The characters and places are the property of Square Enix.
       Setting: After Advent Children and Dirge of Cereberus.
       Type: Multi-chapter
       Status: complete
Public Domain
cloudstrifecompfinalfantasyfinalfantasyviitifalockhart
Table of contents

9 parts

Sign up to add CloTi Story to your library and receive updates
or
Content Guidelines
You may also like
Cataclysmic (Final Fantasy VII) by CelestialShadowWolf
40 parts Complete
Growing up alongside Cloud and Tifa, Lailah Tenebris is a girl whose past is drenched in blood and plagued by death. As a descendant of Gaia, she uses her powers to aid Avalanche in helping the dying planet in hopes it will flourish once again. Cloud Strife x OC **Takes place during FFVII Remake** ***No harem, just pure love and support*** ***CROSSPOSTED TO QUOTEV***
Crossing realities (cloudXreader) by Jardin_dYara
16 parts Ongoing
After weeks of grueling university exams, Y/N eagerly returns to the world of Final Fantasy VII for a much-needed escape. But when a strange noise disrupts her gaming session, she finds herself inexplicably transported to the gritty, sprawling city of Midgar. In this surreal blend of fantasy and reality, Y/N must navigate the dangers and mysteries of a world she once knew only through a screen. Dark forces are at play, and the boundaries between worlds are beginning to blur. With time running out and the stakes higher than ever, Y/N must unravel the secrets of the Lifestream and uncover the true purpose of her journey. Will she find a way back to her world, or is she destined to become a permanent part of Midgar's story? *The characters aren't mine I am just currently obsessed with Cloud lmao enjoy!! * I apologize in advance for any language mistakes, as English isn't my first language!!
Cloud x Tifa - Liquid Arrows (FFVII) by somebodyznightmare
1 part Complete Mature
He found himself thinking again about their intense lovemaking the night before in Kalm and how he had kissed her beneath the wispy leaves of a weeping willow the night prior to that. Ever since he had first laid eyes on her and followed her around Sector7, moving alongside her grace and finesse in battle, there had been a deep, dark possession taking root somewhere inside of his bones, linking him to her in ways that were beginning to feel inextricable and intractable. Third part of "Anxious Hearts Beneath the Sparkle", Following Instead, He Chose to Kiss Her and The Stars In Her Skin.
Cloud x Tifa - Nightcall (You're a Real Hero) FFVII by somebodyznightmare
1 part Complete Mature
Cloti birthday smut for Cloud's birthday.
Cloud x Tifa - The Heat (FFVII) by somebodyznightmare
1 part Complete Mature
A few of Tifa's firsts with Cloud Strife. The Heat never leaves her.
Unburdened At Long Last(Cloud x Harem Stories) by JasonNava7
8 parts Complete Mature
After having beaten Sephiroth and saving the planet, as well as putting down Shinra for good, Cloud and his allies can final get some rest and relaxation back at the newly rebuilt Sector 7 slums. Or so he hoped. Note: This Cloud suffers from philophobia, the fear of falling in love because of the consequences and other mental conditions. Harem: Tifa, Aerith and Jessie
Cloud x Tifa - Gasoline Hearts and Small Desires (FFVII) by somebodyznightmare
1 part Complete Mature
The plate was crashing, their world falling apart around him. But the only thing that concerned him was the way that Tifa fell and gasped, bullets tearing her flesh before she collapsed. And running to her side, he knew that there was so much more to his instincts than his promise to save her. A different take on the events following the Sector7 Plate drop, and Tifa's Resolution.
Cloud x Tifa - Time After Time (Final Fantasy VII) by somebodyznightmare
3 parts Complete Mature
After leaving his hometown and the girl he secretly loves to join SOLDIER and achieve his dreams, Cloud Strife finds that the homesickness and the loneliness are too much to bear alone in the big city, and begins to write the girl of his dreams letters. Years later, when they are reunited, he doesn't remember that she never wrote him back. 99.5% Canon, slight divergence at the end. COMPLETE. FFVII Remake, Final Fantasy VII Comments and feedback welcome! <3
Cloud x Tifa - Last Train to Brooklyn (Final Fantasy VII) by somebodyznightmare
10 parts Complete Mature
New York City is supposed to be the place of big hopes and even bigger dreams. But when Cloud and Tifa reunite there more than a decade after separating in their hometown in Colorado, they're both surrounded by broken promises and empty wishes. It doesn't help that their instant attraction begins to muddle those promises, blurring the lines of their friendship as they both try to figure out who they truly are against the towering spires of the city's skyline. Because guys and girls can't only be friends, can they? Final Fantasy VII, Advent Children, FFVII Remake Comments and feedback welcome! <3
~Her star~ cloud strife x reader by Kenma_bby604
22 parts Complete
Disclaimer: none of these pics/ drawing are mine unless I say so, I do not own any of the characters they are simply from final fantasy 7!! Warnings: may include sexual harassment, rape, language, adult scenes.
You may also like
Slide 1 of 10
Cataclysmic (Final Fantasy VII) cover
Crossing realities (cloudXreader) cover
Cloud x Tifa - Liquid Arrows (FFVII) cover
Cloud x Tifa - Nightcall (You're a Real Hero) FFVII cover
Cloud x Tifa - The Heat (FFVII) cover
Unburdened At Long Last(Cloud x Harem Stories) cover
Cloud x Tifa - Gasoline Hearts and Small Desires (FFVII) cover
Cloud x Tifa - Time After Time (Final Fantasy VII) cover
Cloud x Tifa - Last Train to Brooklyn (Final Fantasy VII) cover
~Her star~ cloud strife x reader cover

Cataclysmic (Final Fantasy VII)

40 parts Complete

Growing up alongside Cloud and Tifa, Lailah Tenebris is a girl whose past is drenched in blood and plagued by death. As a descendant of Gaia, she uses her powers to aid Avalanche in helping the dying planet in hopes it will flourish once again. Cloud Strife x OC **Takes place during FFVII Remake** ***No harem, just pure love and support*** ***CROSSPOSTED TO QUOTEV***

More details