Burning Red~ One Direction
katietommo6
  • Reads 9,616
  • Votes 430
  • Parts 30
  • Time 1h 32m
  • Reads 9,616
  • Votes 430
  • Parts 30
  • Time 1h 32m
katietommo6
Complete, First published Aug 08, 2013
harryliammatchnecklacenecklacssperfect
At birth, each baby, boys and girls, are given a government issued necklace. These necklaces are indestructible and will permanently stay with their owner. Internationally, it was decided hundreds of years ago to use the necklaces as a method to find love. They will lead you to your perfect match. They glow different colors when you get within certain distances from each other. Red when you get close, and blue when you get farther away. Its sort of like a game of hot and cold. With the necklaces, there is no heartbreak and more time can be spent on world productivity. Thats the reason they were created. There has never been a glitch in the entire existence of the system. But that doesn't include me.
All Rights Reserved
harryliammatchnecklacenecklacssperfect
Table of contents

30 parts

Sign up to add Burning Red~ One Direction to your library and receive updates
or
Content Guidelines
You may also like
WHAT THEY SEE by Mya2tact
42 parts Complete Mature
"I got you something." He told her pulling away, while she watched him curiously until he pulled out a pandora bag. Her eyes widened at the necklace with an infinity symbol in crested with small little diamonds. "How you even afford this kari?" She questioned, unable to take her eyes off of it. "Shit, my savings." He rubbed the back of his head that possessed his starter loc twists. "That was so nice of you, you didn't have too." She smiled softly finally looking at him, "Can you put it on me?" He stood behind her and she moved her hair out of the way as he put it around her neck and clipped it back together. Her hand immediately went to it. "I'm never gone take it off." She promised him turning to face him. "I love you kari." "I love you too, hone. Til Infinity." --- When an unfortunate sequence of events suddenly separates two bestfriends, Dakari and Honesty, with no plausible reason, it's shakes up the world of the two inseparable individuals. With no goodbyes shared, Dakari was left feeling alone and heartbroken by the sudden disappearance of the only person outside of family that he cared for deeply. The outside world declared Dakari mad at the world, and he didn't think he could ever get over the missing void created by her absence. When honesty finds herself back where it all began, she discovers the hard way that Dakari no longer wants anything to do with her. The unexpected reunion rekindles unbearable memories of their deep connection and the painful separation that slowly but surely leads them back to each other. It's up to them to pick up the pieces of their broken friendship as they confront their past and face what's in store for their future, whether it's together or apart. They must decide if their love is strong enough to hurdle over the obstacles sent their way from every angle. Is true love worth fighting for no matter how long it takes? Published; Dec 24th, 2023 Finished; July 3rd, 2024
It's all about Black (10 mates) - Finished by AThousandFeathers
67 parts Complete
"... We are wolves, all of us, or partly, we are werewolves. All werewolf has a mate, which is the love of their life, more likely their soul mate, you are ours, meaning that the 10 of us, share you my love, as our mate, you are feeling connected to us, maybe not love yet, but you do feel something for us" Damon told me. My eyes widened in shock, Is he for real? *** --- / IT'S ALL ABOUT BLACK \ --- What happens when a human girl meets not 1, but 10 werewolves claiming to be her mates? Throw in a ghost, an alpha who is not willing to let his sons mate a human girl who causes more trouble than you can possibly imagine, a crazy cousin who knows how to piss off 10 very possesive werewolves, and her own parents who cares about nothing but themselves. And that's not all. How about adding a little magic? ==================================== Confused? read it and you will understand. One thing is sure, being a human troublemagnet and having 10 mates is not easy. *** Enjoy!
Love me crazy ( Jenlisa ) ( GIP ) by Mimita097
27 parts Complete Mature
[ The modern-day Bonnie and Clyde ] . . . . Legend has it that there's an intangible red string that binds two souls destined to be together. No matter the time, place, or circumstance, nothing can break the invisible thread between those two people who are meant to be together. That's what it was like between her and I-an instant connection, like we'd always been together. .. .. She and I, both from traumatized families, found comfort in one another. The girl with the letterman jacket and charismatic smile. And me, her bohemian princess. The invisible string pulling us to one another despite the danger our love created. The town whispered about us. Our parents threatened us to stay away from one another. They tried to cut the string and keep us apart. We simply tied it in chaotic knots, with no hope for ever separating them. .. .. Will our unbreakable bond uphold the chaos fate brought us, or will our love bleed into a pool of crimson?
The Golden Days ~ Sequel to Burning Red, One Direction by katietommo6
16 parts Complete
The Sequel to Burning Red! My necklace led me to two boys, both perfectly suited for me. I had to choose between them, and it caused more trouble than you would believe. Our dramatic past behind us, I look forward to my future with the one I love. Our new life will be perfect, I can just feel it.
The Red String Of Fate | | JJK FF by maknaerealm
88 parts Complete Mature
The red string of fate: Two people connected by red thread are destined to be lovers, regardless of time, place, or circumstances. This magical cord may stretch or tangle but never breaks. ~~~~~••••••~~~~~ "I know that you're no good for me but it's worse without you, even when I try not to want you I end up needing you, you're my favorite joy yet my endless pain. I tried to hate you but the only thing I hated is how much I loved you." What will happen when you find a person who can spark every emotion inside you and still be the one to give you endless pain? Can your heart still love him like it always did? Or maybe your love never changed. Does the red string of fate really exists? #1 in mystery-thriller #1 in agent #2 in jkff #3 in jeongguk #7 in jungkookff #7 in violince #11 in romantic-thriller #149 in tattoos ⚠ Contains Mature Content ⚠
Soulmates by VicMalfoy19
50 parts Complete
With each new child is a new soulmate. Every wizard and their soulmate (if muggle) has a soulmate, a destined life long partner. When a child is born their soulmate is known by their name and status inked on the babies wrist. Unlike the muggle world where you are judged for being homosexual and such, the wizarding world accepts it. A soulmate is destined and can not be changed so there is no point. Well there is one problem in this system. Dumbledore. The "Kind" and "Grandfather figure" does something he can not get away from. He stole the dark lords (Voldemort) and Severus's child. What happens with the child's mate? Will the family be reunited after the tests? How will this all play out and... Will Dumbledore get whats coming to him?
The Multiples by bunnybluewriter
42 parts Complete
At lightning speed I threw open the covers of the bed , checking for any trace of missing clothing ; Every ounce of my fiber, of my being was yelling at me to get out of here ,to run as fast as I could and never look back. I guess in a way , it serves me right for being here again. I was weak. I was too weak to even stand. Watching all the eyes in the room fall on me and my shaking hand , I almost hesitated. But I didn't think. And that's the problem. **** Olivia Davis was no ordinary preppy teenage girl living off of her father's fame and fortune. Living from one shopping spree to the next , riding the best and newest car. Infact , she was the exact opposite of who her father wanted as the princess of his multi billionaire company. She was loud . Cold. And had an attitude that would put her grandmother to shame . She was nothing anyone expected from someone who graduated high school with honours . So what if her graduation gift was the news that she has a fiancé ? Not one . But TWO ! None of which she had a say in what so ever . But they say that two is better than one right? *started 18 June 2019* *finished 26 March 2020* *edited 9 April 2020*
Finally Free by lulustoriesss
62 parts Complete Mature
"I need you to be the put together one because I'm so fucked up. You've saved me." He whispers. "Carter, we saved each other." I mutter looking at him through my eyelashes. I lean into him, our lips not even an inch apart. "Sophia we shouldn't..." He looks hesitant. "Please, I need you." I almost started crying. "Please." I mutter one more time, my eyes begging for him. My body needing him. Sophia Carrington. She just moved from New York to California in search of a new life. When her life took a dark turn she's forced to leave everything behind. She just wants to finish her final year of high school, numb to the world, while learning to cope with the trauma she's endured. Carter Marquez. Newly single after being dumped by his girlfriend of two years. After losing his dad in a car accident he's fallen apart. The list of people he trusts is short, he hates letting people in. He's constantly trying to make up for his mistakes of the past, trying to find a new purpose in life. When the two of them collided, they instantly took a mutual disliking to each other. Misunderstandings and a dash of alcohol set a flame between them. Sophia hates the snarky remarks and stupid nicknames that leave his mouth. Carter thinks Sophia is just another trust fund brat. Soon their rivalry begins to dissolve and they learn that sharing the pain of their past can form connections they never thought to be possible. WARNING: This story contains mature topics such as sexual assault and drug addiction. Read with caution. Copyright © by lulustoriesss 2021
As Cold as Ice (Dangerous Stranger's Book 1) Complete by shru_du
31 parts Complete
you can see it on Amazon Kindle... In the heart of Victorian London lives a girl names Katherine Davis. She is the real life Cinderella yet she was different then her in many ways. She is head strong, stubborn and defies every rule made for the girls by the society. She made one rule for herself that she will never be tied to anyone in marriage. But her fate made her meet the kind of men she despise while she was hunting in the forest Christen Ace Rodriguez and he wanted her because she is the best in what she does. Fate brought them together once again when her father went missing while being on a trip of Egypt. She was attacked by bandits and she missed her escape route. She took shelter on another ship only to be found by none other than Christen Ace Rodriguez. Swords clashed, sparks followed. Will christen be able to win her over? Will Katherine escape her fate and find her father before she fall for him? His words came back to my mind "You should be very ,very afraid." I am now. This Book is published as a e-Book on Amazon https://www.amazon.in/dp/B0769JN1ML/ref=sr_1_4?s=books&ie=UTF8&qid=1507598730&sr=1-4&keywords=As+Cold+As+Ice Link is above for the complete e-book which is kindle unlimited enabled
Invincible ➵h.s by WeTukAChonce_
42 parts Complete
In a futuristic society, love is 'found' through matching bracelets, that are assigned by the government. It is simple system - if the man in front of you has the same bracelet symbol as you, then you are meant to be. But there was one flaw - what if the bracelets were switched, through a third-party? Will their compassion shine through and be able to defy society's view of 'love'? Or does fate have something else in mind?
You may also like
Slide 1 of 10
WHAT THEY SEE cover
It's all about Black (10 mates) - Finished cover
Love me crazy ( Jenlisa ) ( GIP ) cover
The Golden Days ~ Sequel to Burning Red, One Direction cover
The Red String Of Fate | | JJK FF cover
Soulmates cover
The Multiples cover
Finally Free cover
As Cold as Ice (Dangerous Stranger's Book 1) Complete cover
Invincible ➵h.s cover

WHAT THEY SEE

42 parts Complete Mature

"I got you something." He told her pulling away, while she watched him curiously until he pulled out a pandora bag. Her eyes widened at the necklace with an infinity symbol in crested with small little diamonds. "How you even afford this kari?" She questioned, unable to take her eyes off of it. "Shit, my savings." He rubbed the back of his head that possessed his starter loc twists. "That was so nice of you, you didn't have too." She smiled softly finally looking at him, "Can you put it on me?" He stood behind her and she moved her hair out of the way as he put it around her neck and clipped it back together. Her hand immediately went to it. "I'm never gone take it off." She promised him turning to face him. "I love you kari." "I love you too, hone. Til Infinity." --- When an unfortunate sequence of events suddenly separates two bestfriends, Dakari and Honesty, with no plausible reason, it's shakes up the world of the two inseparable individuals. With no goodbyes shared, Dakari was left feeling alone and heartbroken by the sudden disappearance of the only person outside of family that he cared for deeply. The outside world declared Dakari mad at the world, and he didn't think he could ever get over the missing void created by her absence. When honesty finds herself back where it all began, she discovers the hard way that Dakari no longer wants anything to do with her. The unexpected reunion rekindles unbearable memories of their deep connection and the painful separation that slowly but surely leads them back to each other. It's up to them to pick up the pieces of their broken friendship as they confront their past and face what's in store for their future, whether it's together or apart. They must decide if their love is strong enough to hurdle over the obstacles sent their way from every angle. Is true love worth fighting for no matter how long it takes? Published; Dec 24th, 2023 Finished; July 3rd, 2024

More details