Wizarding Worlds Intro to Force Sensitives
Susan_Horak
  • Reads 107
  • Votes 0
  • Parts 5
  • Time 2h 58m
  • Reads 107
  • Votes 0
  • Parts 5
  • Time 2h 58m
Susan_Horak
Ongoing, First published Aug 12, 2013
actionarrangedcrossoverdeathenemyfamilyharryharrypotterhurtlovemarriagepainpotterpregnancystarstarwarswars
The first Jedi’s on Earth comes from a mixed heritage and 3 being related to Harry Potter don’t help much. The Sith are after them and the threat of Lord Voldemort coming back is scary for all. Their love lives are also being tested in ways that they didn’t realize.
Public Domain
actionarrangedcrossoverdeathenemyfamilyharryharrypotterhurtlovemarriagepainpotterpregnancystarstarwarswars
Table of contents

5 parts

Sign up to add Wizarding Worlds Intro to Force Sensitives to your library and receive updates
or
Content Guidelines
You may also like
A Scavenger and a Pilot {Poe Dameron x Reader} by HelyasMage23
27 parts Complete Mature
You're 26 years old. You were born on Hoth, one of the coldest planets in the galaxy. Both your parents abandoned you when you were about 2 years old, so you hardly remember anything. Now you're all grown up, and you take care of yourself. You're a hard-ass free spirit, but things change when you cross paths with a Resistance pilot. Feelings change. (Takes place in the time between the Last Jedi and the Rise of Skywalker) (Disclaimer: the characters or settings in this story do NOT belong to me. All rights and credit is reserved to Lucasfilm and the creators of the Star Wars trilogy. I do not own ANYTHING.)
Daughter of a Sith Lord by AmyDunbar2
26 parts Complete
Y/n is old 6 years old living with an abusive mother and never know about her father. One day Kylo Ren receive world he has daughter. He set out to find her on the plant of Endor. When he find her badly hurt. Sending the force he take her to raise and and teach the ways of the sith.
STAR WARS EPISODE X - The Lord in the Shadows by BSCDV99
22 parts Complete
A new era begins in a galaxy far, far away... Long after the events of the Skywalker Saga, new heroes and villains arise from our favorite space-opera. In the New Republic, both the Senate and the Jedi have to face a unique enemy. The following events will make them question themselves and their ideals.
Gender Swapped by CourtesyTrefflin
9 parts Complete
A Sith curse renders a creepy swamp a trap which will gender swap anyone who happens to activate it. Across universes, changes ripple outward as certain, important, unfortunate individuals stumble onto the curse. But that is only the beginning.
Light and Darkness by JulieMcIntyre4
44 parts Ongoing
Padme gives birth to triplets. First Luke, then Leia, and third Lita. The children are separated to protect them from the Sith. Leia is adopted by a senator and his wife, Luke is taken to live with his family on Tatooine, and Lita is taken to Naboo to live with Padme's family. Will Lita find out the truth about her family's heritage? Or will it find its way to her? And what path will she choose?
Star Wars: Arise Once More (Clone Wars x OC) by LordKage1
20 parts Complete Mature
What happens when a long dead extinct Race return to the Galaxy. The foundations of Republic and CIS will be disrupted by the sudden return but can the Rule of Two Cooperate with the new threat or Perish to it's own ignorance and Pride. Peace is a Lie.
Remnants of Darkness by CourtesyTrefflin
8 parts Complete
Vader, now Anakin, survives the Death Star, but his fight is still far from over. There's something wrong with Luke, something growing steadily darker about him that Anakin doesn't understand. And when Anakin is arrested on false charges of treason against the new Republic, after attacks by his former apprentice, Starkiller, he begins to question what's really happening behind the scenes.
Always In My Head by axo_lesperanza
13 parts Complete
Ben Solo fools around with a fellow Padawan while training at the Jedi Academy. He finds out the hard way that a fellow Jedi scorned with heartbreak and an unplanned pregnancy is not a force to be reckoned with. The desire for her to protect her child and the galaxy creates an insatiable desire for revenge.
Never Walk Alone by CourtesyTrefflin
8 parts Complete
Luke grows up plagued with constant nightmares about what happened on Mustafar. He wants answers about what really happened to his father, answers no one is giving him. He's certain Ben Kenobi is hiding something, both about his own real identity and Luke's father. And his suspicions are confirmed when on the Death Star, he senses who Vader truly is.
Star Wars X - The Phantom Rises by DawnTide
33 parts Complete
(After TROS) Ben is Alive! And Rey becomes pregnant with his children! A new threat known as the Phantom has risen. But everything goes even more pear-shaped when Rey dies at child birth and the newly born twins are taken away from their father. But now 16 years have passed. And the twins, Quin and Reuven, have grown up. Once finding out about their heritage it is time for them to choose which side they're on and what 'they' want to do with their lives. Quin has dreams to become a Jedi Knight just like her mother, take down the Phantom and restore honor back to her family name. But Reuven has other plans. He wants nothing to do with the Jedi, Rebellion nor the Phantom or even the war in general. Follow the Solo twins as they travel to new planets, discover their abilities, face new enemies and make new relationships.
You may also like
Slide 1 of 10
A Scavenger and a Pilot {Poe Dameron x Reader} cover
Daughter of a Sith Lord cover
STAR WARS EPISODE X - The Lord in the Shadows cover
Gender Swapped cover
Light and Darkness cover
Star Wars: Arise Once More (Clone Wars x OC) cover
Remnants of Darkness cover
Always In My Head cover
Never Walk Alone cover
Star Wars X - The Phantom Rises cover

A Scavenger and a Pilot {Poe Dameron x Reader}

27 parts Complete Mature

You're 26 years old. You were born on Hoth, one of the coldest planets in the galaxy. Both your parents abandoned you when you were about 2 years old, so you hardly remember anything. Now you're all grown up, and you take care of yourself. You're a hard-ass free spirit, but things change when you cross paths with a Resistance pilot. Feelings change. (Takes place in the time between the Last Jedi and the Rise of Skywalker) (Disclaimer: the characters or settings in this story do NOT belong to me. All rights and credit is reserved to Lucasfilm and the creators of the Star Wars trilogy. I do not own ANYTHING.)

More details