Beautifully Eternal
BeautifullyEternal
  • Reads 6,191
  • Votes 468
  • Parts 10
  • Time 1h 17m
  • Reads 6,191
  • Votes 468
  • Parts 10
  • Time 1h 17m
BeautifullyEternal
Ongoing, First published Aug 18, 2013
badboybadboygoodgirlbloodcursedarkfairytalefangsfantasyhalfvampirelovematuremysteryparanormalprinceprincessqueenromanceroyaltyvampireyoungadultfiction
Seeds of Hate and Love Can't be Unburied...
In a world where a clock marks a deadly curfew for all human beings, life has a way of entwining two unfortunate souls together. The last thing Anne Ross expected during a snowy Christmas night was to be captured in the midst of Shadows, vampires. Unaware of her royal bloodline or past, she's thrust into a world of timeless elegance, lavish balls, and dark secrets. Determined to escape and find her best friend Jared, she forms a plan that might just cost her, her own life. Yet nothing could have prepared her for the dangerous seductive Alexander Donovan. Who not only loathes her but claims she's his long lost fiancé and is ready to embark on her role as the Queen of the Corvidae Kingdom, bringing an end to the endless feud between their lands. As war and duty to her heritage lay upon her and Alexander's kisses weaken her resolve, Annie is faced with a choice between fighting for her humanity or achieving unbelievable power.
All Rights Reserved
badboybadboygoodgirlbloodcursedarkfairytalefangsfantasyhalfvampirelovematuremysteryparanormalprinceprincessqueenromanceroyaltyvampireyoungadultfiction
Table of contents

10 parts

Sign up to add Beautifully Eternal to your library and receive updates
or
#819badboygoodgirl
Content Guidelines
You may also like
vampire next door by itz_zubi
33 parts Complete
I stared at her fair,voluptuous neck as she tucked her blond hair behind her ear. she scented beautifully as i notice her veins beating furiously. I wanted to dig my fangs into her neck but knew it was against my rules. but this beauty was a temptation to him. meet callidora, a final year hardworking college reporter for the the daily times newspaper. she moves into a new house hoping her life would change for better. but callidora life takes a turn when dead bodies start turning up and she finds out that her sit mate and neighbour is a vampire. meet Clemente, a handsome vampire transfer student. Clemente had lived his whole life in fear. he feared that one day he will be found out. he made his rule to never to suck any human blood and made a living from sucking animal blood. but when he meets callidora, he feels his senses which he had kept hidden for ages come to life. follow callidora and Clemente on their journey on love and darkness
Flames of Ashes by Bimsy_72
27 parts Ongoing Mature
One day. One choice. A murderer, she was called, and now as payment, she is thrown into the brutal knighthood to try and survive. However, she starts to realize that everything she has been taught might very well be a lie. She meets Zarir, Prince of Perisdia, who she is meant to be enemies with but she finds herself in a complicated relationship with him when he declares her to be his. Politics isn't just a game but a meat that means survival for all. Thrown into a world of betrayal, and secrets, her life is in danger, and her future is at stake. Now she has one choice which is to either burn the world to the ground or cleanse it. **** Cover is by the wonderful and talented @preshy_o 💕💕
masked | 18+ by -honeycone-
9 parts Ongoing Mature
𝐁𝐎𝐎𝐊 𝐓𝐇𝐑𝐄𝐄 𝐦𝐚𝐬𝐤𝐞𝐝 (𝘢.) /mɑːskt/ (of one's true character or feelings) concealed. . 𝐌𝐀𝐋𝐈𝐊 𝐂𝐇𝐑𝐈𝐒𝐓 the king. He's the ruler whose brow is laid in thorn, smeared with oil like David's boy. Malik is put well together and never lets his mask fall. Emotions aren't his specialty, and the ones he has, he conceals behind a content mask, that only his inner circle gets to witness. He wears his pride like his crown and holds his head high. Malik is machine-made, and doesn't let his emotions control his better judgment. All of which evaporates when he lays eyes on his fiancé. But what happens when the world he's so familiar with comes crashing down right before his eyes and he's bound to marry a stranger, having to make up for his absent father's mess, again? 𝐀𝐌𝐀𝐍𝐈 𝐐𝐀𝐃𝐈𝐑 is the princess of a small island in the middle of the north African sea. Her father has always been her entire world, and watching her old man kicking the bucket soon, has taken a toll on Amani. Not having her mother's support, due to her passing, she faces the kingdom she is to rule sooner than later, with a mask on her face, as she conceals her true feelings; despair. Amani has always been a sucker for the rules, finding a sense of comfort behind the lines she knows better than to cross. Said lines would be falling in love with any man. But her comfort escapes her body, along with her breath when she learns about her engagement to the man who's an outsider in her world. A foreigner. A businessman from the states, who possesses a British accent. Son of the Libyan foreign minister. With her hands tied to a stranger's she finds herself alone in a world she knows all too well. Both of them are strangers, but will they surprise each other? .
The Only Queen by ladyrose_thewriter
38 parts Complete Mature
[MAFIA ROMANCE, RATED R] "I catch a lot of attention these days," she purred, her voice dripping with seductive allure as she toyed with Cedric's expectations. "But you haven't quite managed to capture mine yet," she teased, her tone coy yet tantalizing. Cedric's expression darkened slightly, a predatory gleam in his eyes as he stepped closer to Lilith, the air charged with electricity between them. "I always get what I want, when I want," he growled softly, his voice low and commanding as he locked eyes with her. ~ In the heart of the male-dominated underworld, Lilith emerges as a formidable force, crowned as the sole queen among her four brothers. It's a destiny written before her birth, a path she must walk to uphold her family's legacy. Tasked by her oldest brother, Lucifer, with using her feminine charm to navigate the treacherous world of organized crime, Lilith finds herself entangled in a web of intrigue, unaware of the intricate game Lucifer is playing. Sin City is akin to hell itself, a domain where Lucifer holds sway, and Lilith is destined to become the Queen of Hell. As Lilith embraces her role, her journey collides with Cedric, an ambitious underworld king ruling the streets of New York. Cedric is determined to make Lilith his queen, regardless of the consequences. Their meeting ignites a fierce clash of wills and desires, propelling them into a whirlwind adventure through the dangerous streets of Sin City and New York. Bound by duty to fulfill her family's legacy by producing an heir, and Cedric's need for a queen to reign over New York, their attraction becomes undeniable. Yet, they must navigate the complexities of their forbidden love, determined to find a way to make it work against all odds, even as the powers of hell itself watch their every move.
A princesses desires by ShadowsGladiatorX
19 parts Complete Mature
A demon princesses 18th birthday is coming up in a few days but she's a love demon so she will go woman hood in her years. As her birthday passes her father assigns her to find a husband or she will be forced one. That until a mortal he goes by Alex Barnes, he got caught in a messy situation and is now being hunted so will his charms be enough to save him and get the attention of a beautiful demon princess or will he have no choice but to rot....read to find out TW: gore, strong language, mentions of mistreatment
Cursed To Be His Bride ✔️ by writer_embers
46 parts Complete
Volume I of Cursed To Be His Bride * * * Edward J. Scott, a young vampire is ordered to bring a human into the Vampire King's castle. But the moment he sees the picture of the beautiful, naive human girl, he knows that she's going to be the death of him, the one to seduce him into breaking all the sacred laws of their society. Elizabeth Mary Browns has been haunted by nightmares for as long as she can remember. But her biggest nightmare comes to her life in the form of a stranger at night. Elizabeth isn't ready to be kidnapped by a vampire let alone be living in the castle full of them. As the shadows rise from the dark, Elizabeth must choose between her and the lives of her friends. She is forced to delve into her past, with the Vampire King on her trail who's hellbent on making her his queen.
Changeling (Book 1) Rated R by BlAckRosE7777777
47 parts Complete Mature
Aimee's life takes a frightening turn when she starts seeing ghosts. Born as a powerful vampire-faerie hybrid and switched at birth with a human child, her entire life has been a lie but now the truth is catching up and fast. When her family is kidnapped and she starts being hunted for her powers, Aimee is forced to enlist the help of a mysterious new stranger who unbeknownst to her is secretly one of the hunters. Burdened with a heritage she doesn't want, and a snarky vampire who she can't deny her attraction to, Aimee's life is going up in flames. With the world burning around her, will she be able to protect what matters most to her?
Sorrow | 18+ by brocolisoeur
40 parts Ongoing Mature
A tale of two sorrowful souls who crossed paths due to a trivial coincidence. His eyes will forever ravish her, his lips will leave eternal marks and one word will haunt her until she dies. She has learnt to be quiet and sweet. He has learnt to dominate and kill. She is trying to find herself from the depths of distray. He is planning to destroy what is needed for power. Falling in love will be too dangerous, too alluring. And in the end it will hurt. Breathing should be effortless, loving should be painless. What does a girl who has learned neither? When you find home in the arms of a killer, to whom you cannot tell your secrets, without risking yourself. And why would you risk anything for a man who believes bullets can fix a broken heart. UPDATES ON SUNDAYS
Her Cinder Throne (Completed) by ViridianHues
105 parts Complete
Cole Glassad couldn't care less about the upcoming palace ball meant to find a wife for the prince. Her life is down in the dangerous Sparkstone mines, slaving away for a few coins that her stepmother and stepsister promptly steal. With life a living hell, she has barely enough energy to care for the injured animals she tends in secret, much less a party for the royal family that cares so little for her and the people like her. It isn't until a mysterious man appears out of the shadows, claiming to be one of the long-lost faeries and offering her a chance at freedom, that she begins to see hope. In exchange for enough money to free herself from her family, the faerie asks only for one thing in return-- that Cole attends the ball in order to get close enough to the prince to assassinate him and bring an end to the corrupted royal line. With her mission clear, Cole enters the world of the palace to learn about the prince and find a way into his ball. But dark secrets, violent plots, a strange sense that perhaps the prince isn't as bad as the faerie makes him seem, and a life-changing discovery about her past, all conspire to make Cole's shot at freedom messy and difficult. She must find the strength to get close to the prince, or else the mysterious faerie will send her back to the mines and her dreadful family. Once the clock strikes midnight... she must fulfill her end of the bargain. Once the clock strikes midnight... her hands must be red with the prince's blood.
You may also like
Slide 1 of 9
vampire next door cover
Flames of Ashes cover
masked | 18+ cover
The Only Queen cover
A princesses desires cover
Cursed To Be His Bride ✔️ cover
Changeling (Book 1) Rated R cover
Sorrow | 18+ cover
Her Cinder Throne (Completed) cover

vampire next door

33 parts Complete

I stared at her fair,voluptuous neck as she tucked her blond hair behind her ear. she scented beautifully as i notice her veins beating furiously. I wanted to dig my fangs into her neck but knew it was against my rules. but this beauty was a temptation to him. meet callidora, a final year hardworking college reporter for the the daily times newspaper. she moves into a new house hoping her life would change for better. but callidora life takes a turn when dead bodies start turning up and she finds out that her sit mate and neighbour is a vampire. meet Clemente, a handsome vampire transfer student. Clemente had lived his whole life in fear. he feared that one day he will be found out. he made his rule to never to suck any human blood and made a living from sucking animal blood. but when he meets callidora, he feels his senses which he had kept hidden for ages come to life. follow callidora and Clemente on their journey on love and darkness

More details