Beautifully Eternal
BeautifullyEternal
  • Reads 6,191
  • Votes 468
  • Parts 10
  • Time 1h 17m
  • Reads 6,191
  • Votes 468
  • Parts 10
  • Time 1h 17m
BeautifullyEternal
Ongoing, First published Aug 18, 2013
badboybadboygoodgirlbloodcursedarkfairytalefangsfantasyhalfvampirelovematuremysteryparanormalprinceprincessqueenromanceroyaltyvampireyoungadultfiction
Seeds of Hate and Love Can't be Unburied...
In a world where a clock marks a deadly curfew for all human beings, life has a way of entwining two unfortunate souls together. The last thing Anne Ross expected during a snowy Christmas night was to be captured in the midst of Shadows, vampires. Unaware of her royal bloodline or past, she's thrust into a world of timeless elegance, lavish balls, and dark secrets. Determined to escape and find her best friend Jared, she forms a plan that might just cost her, her own life. Yet nothing could have prepared her for the dangerous seductive Alexander Donovan. Who not only loathes her but claims she's his long lost fiancé and is ready to embark on her role as the Queen of the Corvidae Kingdom, bringing an end to the endless feud between their lands. As war and duty to her heritage lay upon her and Alexander's kisses weaken her resolve, Annie is faced with a choice between fighting for her humanity or achieving unbelievable power.
All Rights Reserved
badboybadboygoodgirlbloodcursedarkfairytalefangsfantasyhalfvampirelovematuremysteryparanormalprinceprincessqueenromanceroyaltyvampireyoungadultfiction
Table of contents

10 parts

Sign up to add Beautifully Eternal to your library and receive updates
or
#101youngadultfiction
Content Guidelines
You may also like
Into You by NBFemProtagonist
10 parts Ongoing Mature
"Whoever coined the term 'High School Sweetheart' never met Collin Ayers." Paige Thompson, an aspiring singer/songwriter, always felt like the late bloomer of her tight-knit, wild friend group, which included her older sister and music duo partner. While her friends were busy building their reputations and living out stories that would become legends in their hometown, Paige quietly watched from the sidelines, often plagued by FOMO. But now, armed with newfound confidence, she's determined to experience life to the fullest-both to inspire her music and to make a name for herself in the songwriting world. That all changes when she spends a summer alone with Collin Ayers, Mount Pine's notorious hockey prodigy. Collin, known for being either the life of the party or its biggest menace, has long embraced his role as the town's wild boy. His hobbies included getting hammered, hooking up, and stirring up trouble-making him the go-to guy for meaningless hookups at house parties. But as the summer unfolds, Collin finds himself drawn to Paige in a way he's never felt before. The resident heartbreaker starts craving something more, something real. Despite the messy breakup between Collin and her sister's best friend, Paige becomes irresistible to him, stirring feelings that he's never experienced. But can someone as self-destructive as Collin keep something good without ruining it? Neither could have predicted that one Spring Break would spark a bittersweet entanglement that would follow them for years. Now, as adults, Paige and Collin must face the unresolved pain and distrust from their high school days if they hope to rekindle what they once had. But can they emerge from their tangled past unscathed, or will history repeat itself?
MALICIOUS [BXB] by SmileOfSketch
23 parts Complete
SEQUEL TO 'THE BLOODLUST CHRONICLES'! "FᎬᎪᎡ ᎢᎻᎬ ᏟᎾᏙᎬN. FᎬᎪᎡ ᎢᎻᎬ ᎠᎪᎡK ᏞᎾᎡᎠ." 𖤐 Donovan Thornhill knows he's a witch - and that something dark will occur to him in October. Well, he also loves his boyfriend and friends. But that's all he knows. And when he gets his Calling, Donovan begins to realize what hides in the coven of his town, making him question what is worth believing in: the King of Darkness or his own people?
vampire next door by itz_zubi
33 parts Complete
I stared at her fair,voluptuous neck as she tucked her blond hair behind her ear. she scented beautifully as i notice her veins beating furiously. I wanted to dig my fangs into her neck but knew it was against my rules. but this beauty was a temptation to him. meet callidora, a final year hardworking college reporter for the the daily times newspaper. she moves into a new house hoping her life would change for better. but callidora life takes a turn when dead bodies start turning up and she finds out that her sit mate and neighbour is a vampire. meet Clemente, a handsome vampire transfer student. Clemente had lived his whole life in fear. he feared that one day he will be found out. he made his rule to never to suck any human blood and made a living from sucking animal blood. but when he meets callidora, he feels his senses which he had kept hidden for ages come to life. follow callidora and Clemente on their journey on love and darkness
The Only Queen by ladyrose_thewriter
38 parts Complete Mature
[MAFIA ROMANCE, RATED R] "I catch a lot of attention these days," she purred, her voice dripping with seductive allure as she toyed with Cedric's expectations. "But you haven't quite managed to capture mine yet," she teased, her tone coy yet tantalizing. Cedric's expression darkened slightly, a predatory gleam in his eyes as he stepped closer to Lilith, the air charged with electricity between them. "I always get what I want, when I want," he growled softly, his voice low and commanding as he locked eyes with her. ~ In the heart of the male-dominated underworld, Lilith emerges as a formidable force, crowned as the sole queen among her four brothers. It's a destiny written before her birth, a path she must walk to uphold her family's legacy. Tasked by her oldest brother, Lucifer, with using her feminine charm to navigate the treacherous world of organized crime, Lilith finds herself entangled in a web of intrigue, unaware of the intricate game Lucifer is playing. Sin City is akin to hell itself, a domain where Lucifer holds sway, and Lilith is destined to become the Queen of Hell. As Lilith embraces her role, her journey collides with Cedric, an ambitious underworld king ruling the streets of New York. Cedric is determined to make Lilith his queen, regardless of the consequences. Their meeting ignites a fierce clash of wills and desires, propelling them into a whirlwind adventure through the dangerous streets of Sin City and New York. Bound by duty to fulfill her family's legacy by producing an heir, and Cedric's need for a queen to reign over New York, their attraction becomes undeniable. Yet, they must navigate the complexities of their forbidden love, determined to find a way to make it work against all odds, even as the powers of hell itself watch their every move.
Smoke and Mirrors : Royal Angels I by TabbyMax
72 parts Complete
He was the prince who got away. He had it all - power, fame, glory, honor. (Did I mention the unlimited supply of money, alcohol and women?) Yet he chose the human world. She wasn't shy, quiet or even remotely sweet. She wasn't your girl next door and she certainly was not a princess. When Victoria is hired to kill a mysterious stranger, she didn't know she was dealing with royalty. Of the immortal kind. Their worlds are about to get intertwined in a way neither could've foreseen. Welcome to a place where pretences are everything and everyone lies to get what they want. There will be scandals. Conspiracies. Betrayal. Love. Vampires, angels, magic and smoking hot men. And of course, a whole lot of "What the hell just happened?" *** Current ranking - #1 on Fantasy Wattpad Featured book Fiction Award Winner 2017 Completed
Inevitable by Wxnterwxlf
46 parts Complete
She was found in the woods, abandoned by her family, at just the age of 1. He found her, and was besotted by her, at just the age of 4. True childhood sweethearts, Easton and Noelle were inseparable. However, growing a liking towards each other at such young ages comes at a price, especially when you are the future Vampire King. All residents in the Kingdom of Highland had heard of the news. A baby girl found, wrapped up in a baby pink blanket, in the mystic woods, by none other than their King. Under the spell of the tiny thing, all the Vampires loved and adored her. What they didn't know, was that she was a fox shifter. And not just any fox shifter, the only remaining one. She was a diamond in the rough, and everyone wanted her, especially since she had killer powers, the perfect weapon against all enemies. I guess you could say, the chances of her being taken, were inevitable. ============================================================ "My King! Over here, look!", the voice caught the attention of Alexander Mitchell. He carried his stubborn 4 year old son, Easton, who was determined to go with them, towards the voice. "Dad, take me to her! Please?" Easton pleaded, his father didn't know what he was talking about. He thought Easton had gone mad. After a few more steps, wails and whimpers were heard. Alexander quickened his stride, jogging to the source of sound. What he saw absolutely shocked him. His loyal companion, standing beside a small basket, and inside, a baby girl. He stood there, mouth agape and feet stuck. Easton struggled against his fathers hold, causing Alexander to place him on the floor. He ran over to the basket, kneeling down, coming face-to-face with the small girl. She had stop crying once she saw the small boy in front of her, causing him to smile triumphantly. "I finally found you."
The Hidden Crown: A Princess's Awakening by KiaraKiddle
30 parts Complete Mature
Living a seemingly ordinary life, high school senior Amelia Garrison thinks she has it all. A good family, amazing friends, perfect grades. That is until her life is turned upside down when a Halloween party leads her into a world of Elves and Faeries, where she must navigate between good and evil. Trying to find the truth about herself and her true parentage, Amelia and her friends must travel through a new world in search of the truth. But time is of the essence, as an evil Lord is trying to take over Ostrya and rule it for himself. While trying to understand her new reality, Amelia must also fight her feelings. Drawn to two of her best friends, Amelia must choose who the right one is for her. Gaining friendships and loosing some along the way, Amelia learns how to manage her new life. Will Amelia beat the clock that's ticking down? Will she discover the truth about herself and her family? Will she finally choose between her two lovers?
The Hookup With Mr. Badboy by ajixreads
30 parts Complete Mature
Alexandra "Alex" Martin. She has the popularity, the fortune, the cold and ruthless look, and the brains. She had everything a teenager could ask for, but there were secrets behind her act, a secret so deep that she'll never share it until it came to one guy, Christian "Chris" Johnson. He also has the popularity, fortune, and the cold and ruthless look, but he had no flaws. He was the epitome of perfection and beauty. On one drunken night, they create the biggest mistake of their lives together. Who knew that they would coincidentally begin living together. Their mistake became fate, and fate became destiny. ~The flawed plus the flawless equals perfection.~ *timing in the book is off. It will be fixed and I decided that the plot starts in november*
Blame It On Fate by wordistic_123
44 parts Complete
Having a big fat crush on two of the best looking guys in school, at different times of course, no issues. After passing out no contact with them, no issues. Going on a family trip through a plane and guess who do you meet on the way? Well yeah that's what happened with Elyse Sanders. She's a girl with a bubbly personality, fun-loving, always smiling, tries to make everyone happy. But who knows what's behind that pretty smile? And yeah she's not exactly your 'Good girl type.' Who's going to end up with her? How many hearts would break in the time span of this vacation? How many secrets would be revealed? Read to find out.......
You may also like
Slide 1 of 9
Into You cover
MALICIOUS [BXB] cover
vampire next door cover
The Only Queen cover
Smoke and Mirrors : Royal Angels I cover
Inevitable cover
The Hidden Crown: A Princess's Awakening cover
The Hookup With Mr. Badboy cover
Blame It On Fate cover

Into You

10 parts Ongoing Mature

"Whoever coined the term 'High School Sweetheart' never met Collin Ayers." Paige Thompson, an aspiring singer/songwriter, always felt like the late bloomer of her tight-knit, wild friend group, which included her older sister and music duo partner. While her friends were busy building their reputations and living out stories that would become legends in their hometown, Paige quietly watched from the sidelines, often plagued by FOMO. But now, armed with newfound confidence, she's determined to experience life to the fullest-both to inspire her music and to make a name for herself in the songwriting world. That all changes when she spends a summer alone with Collin Ayers, Mount Pine's notorious hockey prodigy. Collin, known for being either the life of the party or its biggest menace, has long embraced his role as the town's wild boy. His hobbies included getting hammered, hooking up, and stirring up trouble-making him the go-to guy for meaningless hookups at house parties. But as the summer unfolds, Collin finds himself drawn to Paige in a way he's never felt before. The resident heartbreaker starts craving something more, something real. Despite the messy breakup between Collin and her sister's best friend, Paige becomes irresistible to him, stirring feelings that he's never experienced. But can someone as self-destructive as Collin keep something good without ruining it? Neither could have predicted that one Spring Break would spark a bittersweet entanglement that would follow them for years. Now, as adults, Paige and Collin must face the unresolved pain and distrust from their high school days if they hope to rekindle what they once had. But can they emerge from their tangled past unscathed, or will history repeat itself?

More details