Beautifully Eternal
BeautifullyEternal
  • LECTURAS 6,191
  • Votos 468
  • Partes 10
  • Hora 1h 17m
  • LECTURAS 6,191
  • Votos 468
  • Partes 10
  • Hora 1h 17m
BeautifullyEternal
Continúa, Has publicado ago 18, 2013
badboybadboygoodgirlbloodcursedarkfairytalefangsfantasyhalfvampirelovematuremysteryparanormalprinceprincessqueenromanceroyaltyvampireyoungadultfiction
Seeds of Hate and Love Can't be Unburied...
In a world where a clock marks a deadly curfew for all human beings, life has a way of entwining two unfortunate souls together. The last thing Anne Ross expected during a snowy Christmas night was to be captured in the midst of Shadows, vampires. Unaware of her royal bloodline or past, she's thrust into a world of timeless elegance, lavish balls, and dark secrets. Determined to escape and find her best friend Jared, she forms a plan that might just cost her, her own life. Yet nothing could have prepared her for the dangerous seductive Alexander Donovan. Who not only loathes her but claims she's his long lost fiancé and is ready to embark on her role as the Queen of the Corvidae Kingdom, bringing an end to the endless feud between their lands. As war and duty to her heritage lay upon her and Alexander's kisses weaken her resolve, Annie is faced with a choice between fighting for her humanity or achieving unbelievable power.
Todos los derechos reservados
badboybadboygoodgirlbloodcursedarkfairytalefangsfantasyhalfvampirelovematuremysteryparanormalprinceprincessqueenromanceroyaltyvampireyoungadultfiction
Tabla de contenidos

10 partes

Regístrate para añadir Beautifully Eternal a tu biblioteca y recibir actualizaciones
or
#547youngadultfiction
Pautas de Contenido
Quizás también te guste
Cursed To Be His Bride ✔️ de writer_embers
46 Partes Concluida
Volume I of Cursed To Be His Bride * * * Edward J. Scott, a young vampire is ordered to bring a human into the Vampire King's castle. But the moment he sees the picture of the beautiful, naive human girl, he knows that she's going to be the death of him, the one to seduce him into breaking all the sacred laws of their society. Elizabeth Mary Browns has been haunted by nightmares for as long as she can remember. But her biggest nightmare comes to her life in the form of a stranger at night. Elizabeth isn't ready to be kidnapped by a vampire let alone be living in the castle full of them. As the shadows rise from the dark, Elizabeth must choose between her and the lives of her friends. She is forced to delve into her past, with the Vampire King on her trail who's hellbent on making her his queen.
The Hidden Crown: A Princess's Awakening de KiaraKiddle
30 Partes Concluida Contenido adulto
Living a seemingly ordinary life, high school senior Amelia Garrison thinks she has it all. A good family, amazing friends, perfect grades. That is until her life is turned upside down when a Halloween party leads her into a world of Elves and Faeries, where she must navigate between good and evil. Trying to find the truth about herself and her true parentage, Amelia and her friends must travel through a new world in search of the truth. But time is of the essence, as an evil Lord is trying to take over Ostrya and rule it for himself. While trying to understand her new reality, Amelia must also fight her feelings. Drawn to two of her best friends, Amelia must choose who the right one is for her. Gaining friendships and loosing some along the way, Amelia learns how to manage her new life. Will Amelia beat the clock that's ticking down? Will she discover the truth about herself and her family? Will she finally choose between her two lovers?
Inevitable de Wxnterwxlf
46 Partes Concluida
She was found in the woods, abandoned by her family, at just the age of 1. He found her, and was besotted by her, at just the age of 4. True childhood sweethearts, Easton and Noelle were inseparable. However, growing a liking towards each other at such young ages comes at a price, especially when you are the future Vampire King. All residents in the Kingdom of Highland had heard of the news. A baby girl found, wrapped up in a baby pink blanket, in the mystic woods, by none other than their King. Under the spell of the tiny thing, all the Vampires loved and adored her. What they didn't know, was that she was a fox shifter. And not just any fox shifter, the only remaining one. She was a diamond in the rough, and everyone wanted her, especially since she had killer powers, the perfect weapon against all enemies. I guess you could say, the chances of her being taken, were inevitable. ============================================================ "My King! Over here, look!", the voice caught the attention of Alexander Mitchell. He carried his stubborn 4 year old son, Easton, who was determined to go with them, towards the voice. "Dad, take me to her! Please?" Easton pleaded, his father didn't know what he was talking about. He thought Easton had gone mad. After a few more steps, wails and whimpers were heard. Alexander quickened his stride, jogging to the source of sound. What he saw absolutely shocked him. His loyal companion, standing beside a small basket, and inside, a baby girl. He stood there, mouth agape and feet stuck. Easton struggled against his fathers hold, causing Alexander to place him on the floor. He ran over to the basket, kneeling down, coming face-to-face with the small girl. She had stop crying once she saw the small boy in front of her, causing him to smile triumphantly. "I finally found you."
The Only Queen de ladyrose_thewriter
38 Partes Concluida Contenido adulto
[MAFIA ROMANCE, RATED R] "I catch a lot of attention these days," she purred, her voice dripping with seductive allure as she toyed with Cedric's expectations. "But you haven't quite managed to capture mine yet," she teased, her tone coy yet tantalizing. Cedric's expression darkened slightly, a predatory gleam in his eyes as he stepped closer to Lilith, the air charged with electricity between them. "I always get what I want, when I want," he growled softly, his voice low and commanding as he locked eyes with her. ~ In the heart of the male-dominated underworld, Lilith emerges as a formidable force, crowned as the sole queen among her four brothers. It's a destiny written before her birth, a path she must walk to uphold her family's legacy. Tasked by her oldest brother, Lucifer, with using her feminine charm to navigate the treacherous world of organized crime, Lilith finds herself entangled in a web of intrigue, unaware of the intricate game Lucifer is playing. Sin City is akin to hell itself, a domain where Lucifer holds sway, and Lilith is destined to become the Queen of Hell. As Lilith embraces her role, her journey collides with Cedric, an ambitious underworld king ruling the streets of New York. Cedric is determined to make Lilith his queen, regardless of the consequences. Their meeting ignites a fierce clash of wills and desires, propelling them into a whirlwind adventure through the dangerous streets of Sin City and New York. Bound by duty to fulfill her family's legacy by producing an heir, and Cedric's need for a queen to reign over New York, their attraction becomes undeniable. Yet, they must navigate the complexities of their forbidden love, determined to find a way to make it work against all odds, even as the powers of hell itself watch their every move.
Smoke and Mirrors : Royal Angels I de TabbyMax
72 Partes Concluida
He was the prince who got away. He had it all - power, fame, glory, honor. (Did I mention the unlimited supply of money, alcohol and women?) Yet he chose the human world. She wasn't shy, quiet or even remotely sweet. She wasn't your girl next door and she certainly was not a princess. When Victoria is hired to kill a mysterious stranger, she didn't know she was dealing with royalty. Of the immortal kind. Their worlds are about to get intertwined in a way neither could've foreseen. Welcome to a place where pretences are everything and everyone lies to get what they want. There will be scandals. Conspiracies. Betrayal. Love. Vampires, angels, magic and smoking hot men. And of course, a whole lot of "What the hell just happened?" *** Current ranking - #1 on Fantasy Wattpad Featured book Fiction Award Winner 2017 Completed
Changeling (Book 1) Rated R de BlAckRosE7777777
47 Partes Concluida Contenido adulto
Aimee's life takes a frightening turn when she starts seeing ghosts. Born as a powerful vampire-faerie hybrid and switched at birth with a human child, her entire life has been a lie but now the truth is catching up and fast. When her family is kidnapped and she starts being hunted for her powers, Aimee is forced to enlist the help of a mysterious new stranger who unbeknownst to her is secretly one of the hunters. Burdened with a heritage she doesn't want, and a snarky vampire who she can't deny her attraction to, Aimee's life is going up in flames. With the world burning around her, will she be able to protect what matters most to her?
Her Cinder Throne (Completed) de ViridianHues
105 Partes Concluida
Cole Glassad couldn't care less about the upcoming palace ball meant to find a wife for the prince. Her life is down in the dangerous Sparkstone mines, slaving away for a few coins that her stepmother and stepsister promptly steal. With life a living hell, she has barely enough energy to care for the injured animals she tends in secret, much less a party for the royal family that cares so little for her and the people like her. It isn't until a mysterious man appears out of the shadows, claiming to be one of the long-lost faeries and offering her a chance at freedom, that she begins to see hope. In exchange for enough money to free herself from her family, the faerie asks only for one thing in return-- that Cole attends the ball in order to get close enough to the prince to assassinate him and bring an end to the corrupted royal line. With her mission clear, Cole enters the world of the palace to learn about the prince and find a way into his ball. But dark secrets, violent plots, a strange sense that perhaps the prince isn't as bad as the faerie makes him seem, and a life-changing discovery about her past, all conspire to make Cole's shot at freedom messy and difficult. She must find the strength to get close to the prince, or else the mysterious faerie will send her back to the mines and her dreadful family. Once the clock strikes midnight... she must fulfill her end of the bargain. Once the clock strikes midnight... her hands must be red with the prince's blood.
Sorrow | 18+ de brocolisoeur
38 Partes Continúa Contenido adulto
A tale of two sorrowful souls who crossed paths due to a trivial coincidence. His eyes will forever ravish her, his lips will leave eternal marks and one word will haunt her until she dies. She has learnt to be quiet and sweet. He has learnt to dominate and kill. She is trying to find herself from the depths of distray. He is planning to destroy what is needed for power. Falling in love will be too dangerous, too alluring. And in the end it will hurt. Breathing should be effortless, loving should be painless. What does a girl who has learned neither? When you find home in the arms of a killer, to whom you cannot tell your secrets, without risking yourself. And why would you risk anything for a man who believes bullets can fix a broken heart. UPDATES ON SUNDAYS
A princesses desires de ShadowsGladiatorX
19 Partes Concluida Contenido adulto
A demon princesses 18th birthday is coming up in a few days but she's a love demon so she will go woman hood in her years. As her birthday passes her father assigns her to find a husband or she will be forced one. That until a mortal he goes by Alex Barnes, he got caught in a messy situation and is now being hunted so will his charms be enough to save him and get the attention of a beautiful demon princess or will he have no choice but to rot....read to find out TW: gore, strong language, mentions of mistreatment
Into You de NBFemProtagonist
9 Partes Continúa Contenido adulto
"Whoever coined the term 'High School Sweetheart' never met Collin Ayers." Paige Thompson, an aspiring singer/songwriter, always felt like the late bloomer of her tight-knit, wild friend group, which included her older sister and music duo partner. While her friends were busy building their reputations and living out stories that would become legends in their hometown, Paige quietly watched from the sidelines, often plagued by FOMO. But now, armed with newfound confidence, she's determined to experience life to the fullest-both to inspire her music and to make a name for herself in the songwriting world. That all changes when she spends a summer alone with Collin Ayers, Mount Pine's notorious hockey prodigy. Collin, known for being either the life of the party or its biggest menace, has long embraced his role as the town's wild boy. His hobbies included getting hammered, hooking up, and stirring up trouble-making him the go-to guy for meaningless hookups at house parties. But as the summer unfolds, Collin finds himself drawn to Paige in a way he's never felt before. The resident heartbreaker starts craving something more, something real. Despite the messy breakup between Collin and her sister's best friend, Paige becomes irresistible to him, stirring feelings that he's never experienced. But can someone as self-destructive as Collin keep something good without ruining it? Neither could have predicted that one Spring Break would spark a bittersweet entanglement that would follow them for years. Now, as adults, Paige and Collin must face the unresolved pain and distrust from their high school days if they hope to rekindle what they once had. But can they emerge from their tangled past unscathed, or will history repeat itself?
Quizás también te guste
Slide 1 of 10
Cursed To Be His Bride ✔️ cover
The Hidden Crown: A Princess's Awakening cover
Inevitable cover
The Only Queen cover
Smoke and Mirrors : Royal Angels I cover
Changeling (Book 1) Rated R cover
Her Cinder Throne (Completed) cover
Sorrow | 18+ cover
A princesses desires cover
Into You cover

Cursed To Be His Bride ✔️

46 Partes Concluida

Volume I of Cursed To Be His Bride * * * Edward J. Scott, a young vampire is ordered to bring a human into the Vampire King's castle. But the moment he sees the picture of the beautiful, naive human girl, he knows that she's going to be the death of him, the one to seduce him into breaking all the sacred laws of their society. Elizabeth Mary Browns has been haunted by nightmares for as long as she can remember. But her biggest nightmare comes to her life in the form of a stranger at night. Elizabeth isn't ready to be kidnapped by a vampire let alone be living in the castle full of them. As the shadows rise from the dark, Elizabeth must choose between her and the lives of her friends. She is forced to delve into her past, with the Vampire King on her trail who's hellbent on making her his queen.

Más detalles