Wwe Facts
JonesyJay
  • Reads 252
  • Votes 4
  • Parts 4
  • Time <5 mins
  • Reads 252
  • Votes 4
  • Parts 4
  • Time <5 mins
JonesyJay
Ongoing, First published Jul 22, 2016
bigcassdeanambrosedivaspaigerawvssmackdownromanreginssashabanksshaneomacstephinesuperstarswwewwedraftwwerawwweslamwwesmackdownwwesupercard
This is going to be facts about Wwe Superstar's and Diva's. I'm going to post about 1-3 facts per day about different Wwe superstars/Diva's.
Public Domain
bigcassdeanambrosedivaspaigerawvssmackdownromanreginssashabanksshaneomacstephinesuperstarswwewwedraftwwerawwweslamwwesmackdownwwesupercard
Table of contents

4 parts

Sign up to add Wwe Facts to your library and receive updates
or
#8bigcass
Content Guidelines
You may also like
Leah's Writer's Room by flowersforleah
12 parts Ongoing
Want to ask me questions? See my behind the scenes? Even see my upcoming story sneak peeks? Here you can request for a chapter read request as well as critique. There's even something better-talking to me about anything you want!
You may also like
Slide 1 of 1
Leah's Writer's Room cover

Leah's Writer's Room

12 parts Ongoing

Want to ask me questions? See my behind the scenes? Even see my upcoming story sneak peeks? Here you can request for a chapter read request as well as critique. There's even something better-talking to me about anything you want!

More details