Story cover for Blonde Jokes. by nataliecw
Blonde Jokes.
nataliecw
  • WpView
    Reads 1,563,886
  • WpVote
    Votes 37,694
  • WpPart
    Parts 62
  • WpHistory
    Time 35m
  • WpView
    Reads 1,563,886
  • WpVote
    Votes 37,694
  • WpPart
    Parts 62
  • WpHistory
    Time 35m
nataliecw
Ongoing, First published Feb 07, 2012
Mature
accidentaccordionairalligatorangryapplearizonaarkansasattackblackblondeblondesbooksbowlingboxbreathebrokenbrotherbrunettebusbusycarcatchingcellcerealcheerioschicagochildchristmascindycirclecivilizationclasscoatcoatscokecollarscomputercookiecopcopscrashcrydeaddebrisdecorateddeerdeltadentsdewdialdirectionsdisneylanddoctordrowndumbearthquakeeatingeconomyelevatorelkentertainmentexecutionfallingfanferrarifirefirstfishingflyingfoodfrenchgamegeniegodgorillagrenadegunguygymhailstormhairhaircuthangerheadheadphoneshearthelicopterhelphighwayhollowhomehorseshourshousehusbandiceinstructorjailjokesjudgingjumpjumpingkeyskidnapkittylandmarkslawyerlemonlessonslicenselineslotterylouisianamagnetsmailmailboxmanmarsmathmercedesmeteormicrowavemirrormoneymonstermoosemountainmoviemurdernasanaturalnewspaintparachuteperfumephonepizzaplanepokiespolicepoliticspoolporchporschepresidentpuppypuzzleransomredred-headredheadrepairribbonsriderightroostersaturnseattleshoessmartsmokesnowmanspeedingsportsspritestickerstuffingsuicidesunsupportswampstechtelevisiontgifthanksgivingthreetickettigertogethertoolstornadotrackstraintreetruckturkeytwoventriloquistwhitewifewindowwindowswinterwrong
Blonde Jokes :) if you think they're funny, you can tell them to your friends :)
Public Domain
accidentaccordionairalligatorangryapplearizonaarkansasattackblackblondeblondesbooksbowlingboxbreathebrokenbrotherbrunettebusbusycarcatchingcellcerealcheerioschicagochildchristmascindycirclecivilizationclasscoatcoatscokecollarscomputercookiecopcopscrashcrydeaddebrisdecorateddeerdeltadentsdewdialdirectionsdisneylanddoctordrowndumbearthquakeeatingeconomyelevatorelkentertainmentexecutionfallingfanferrarifirefirstfishingflyingfoodfrenchgamegeniegodgorillagrenadegunguygymhailstormhairhaircuthangerheadheadphoneshearthelicopterhelphighwayhollowhomehorseshourshousehusbandiceinstructorjailjokesjudgingjumpjumpingkeyskidnapkittylandmarkslawyerlemonlessonslicenselineslotterylouisianamagnetsmailmailboxmanmarsmathmercedesmeteormicrowavemirrormoneymonstermoosemountainmoviemurdernasanaturalnewspaintparachuteperfumephonepizzaplanepokiespolicepoliticspoolporchporschepresidentpuppypuzzleransomredred-headredheadrepairribbonsriderightroostersaturnseattleshoessmartsmokesnowmanspeedingsportsspritestickerstuffingsuicidesunsupportswampstechtelevisiontgifthanksgivingthreetickettigertogethertoolstornadotrackstraintreetruckturkeytwoventriloquistwhitewifewindowwindowswinterwrong
Table of contents

62 parts

Sign up to add Blonde Jokes. to your library and receive updates
or
Content Guidelines
You may also like
Stupid Cupid Had Me Falling For The Leader Of The Drapes by AmariannaRose
4 parts Complete
**I'm new to the Cry-Baby world and have only watched it once.... well twice since I'll be watching it as I write this story but I've been reading some Johnny Depp One shots.... which is how I was "introduced" to Cry-Baby an it "put me in the mood" to try my hand at writing a Cry-Baby story and this is it I'm sorry if I get anything wrong and/or people seem out of character** Cadence Clearwater who was named after her uncle Creedence was best friends with "Crybaby" Wade Walker and Mona "Hatchet-Face" Malnorowski when she was a child she was forced to move out of Baltimore when her father decided to move his family when she was 10 years old but she made a promise to Wade in a letter which said once she was old enough to live on her own she'd come back home to him and she keeps her promise after she graduates from school at the age of 18 but she isn't alone for she had adopted her 5 year old brother and sister to keep them away from their abusive father after their mother died the only issue is when she comes back Wade doesn't seem to remember her Mona does though Wade and Cadence remeet when she walks into a Candy Store looking for a job then again at Turkey Point where she "saves" him from Lenora Frigid by kissing him in front of her and saying he's "her man" it's a instant attraction for Wade but what about Cadence!? will she let him steal her heart like she let him have her first kiss!? what about Allison!? what sort or relationship will Wade have with the "Square" girl who instantly fell for him and his one lonely tear!?
All I Ever Wanted by number1swifty
47 parts Complete
Emma's life was never perfect. She never had the nice house, white picket fence and a beautiful labrador puppy. She never wanted any of that anyway. All she ever wanted was loving parents for her and her sister. She's come to terms with the fact that it's never going to happen. Mike had it even worse. But for him it's in the past and all he wants to do is move on and forget. But it's not as easy as it sounds. Then one day there paths cross in the most unlikley of situations...
Why do I love you? (COMPLETED!!! In editing process) by chanina123
30 parts Complete
Cherlninda died. 1009 years ago. Her best friend turned her into a vampire. Leaving her life behind. So in her earlier years in the years while hunting with her family. Her sister Alicesenia was attacked by a wolf and the wolf seriously effected Cherlninda. At school she sees this wolf again. Hes a alpha and 1009 years ago he was her boyfriend. They really hate each other. But... Even though they hate each other... They love each other... And they are mates... Impossible? Well believe it.
Living it Big Time ~ A Big Time Rush Fan Fiction :{) by immaRUSHER05
28 parts Complete
Nathalie has spent years dreaming about anything and everything about her favourite band, Big Time Rush. When her dad receives a job at Paramount Studios in America, she and her family have to move to the other side of the world to be with her dad. When her dad shows her around his new work, she meets Big Time Rush. She's been dreaming about this day forever but will she become their friend, or even better, one of their girlfriends or will she be stuck in the 'rusher' zone?
I am the King, Right? by cheesydancer
40 parts Complete
Michael Zanaya was crowned king of Arsom when he was only four. His father recently died of cancer and his mother disappeared when he was little. 13 years later, how can Michael deal with being one of the youngest kings with his Uncle Harold as advisor? What happens when one of his oldest friends comes back to him? This is a modern day monarchy, filled with misconceptions, secret plans and more than one evil plot :D
Merely Lust by annadez
20 parts Complete Mature
One night with Nikolas is all any woman can expect. He is a seducer, a rake, a sexy vampire who promises nothing but one night of utter fulfillment to all of his conquests. Iris gives in to him for one night of hot, passionate, mind-blowing sex but leaves something behind that she plans to recover. However, when she finally finds the illusive Casanova, he has a proposition to make that could put something much more important in danger: her heart.
Everyone Needs A Hero.... Even You. A reader x Leonardo by Bit_h_
55 parts Complete
BANG. Pain exploded through my leg, knocking me to the floor. "They shot me-my fucking leg!" I screamed, trying to breathe through the panic. My first day working at the museum turned into a nightmare when the Purple Dragons attacked. They found me hiding and shot me, and everything blurred-until a green mutant appeared out of nowhere, trying to save me and the stolen artifacts. I couldn't stand on my own, so he made a split-second decision to take me to his lair, hoping his brother Donnie could help. While recovering, I learned about Leo, his family, the Kraang, and the Foot Clan. I grew close to him-and terrified of his constant need to play hero. Every mission felt like another chance he wouldn't come back. But while I worried about him, something began happening to me: the voices, the visions, the emotions I didn't understand, especially when it came to that blue-masked turtle. Now I have two questions: What's happening to me-and can I save Leo before it's too late? Started on Jan.3 2021 Holly crap 10 reads already?!? 20 reads?!?! And someone added to their library?!?! BRO thank you!! 40 reads and 2 story's omg. This is amazing.! Thank you so much!, 100 flipping reads?!? (School is being hectic as heck so expect new parts every weekend) 200?!? Wtffffff 300. 400?!?! You guys are insane!! 500?"?!"!?! BRUH WTFFFFF❤️❤️❤️ 32k 👁👁 bro what. 75k... guys I wrote this when I was 12... (yes I did rewrite the description-it was bugging me.)
Something Worth Fighting For by preciious-diamondz
47 parts Complete
What would you fight for? Your best friends, the people in your town, perhaps your country, or maybe even a second chance at love?
My Killer Romance by iguana95
35 parts Complete
Alice was perfectly fine living the highly secretive and cavalier life she had. Honestly, between the exotic locations and to die for gadgets, life couldn't get any better, and she was content thinking she was the only one of her kind. That was until she met him. Ever since that day on the airplane he's been doing nothing but turning her world upside down and then some. That is to say, in a world full of adventure she wasn't expecting this one.
You may also like
Slide 1 of 9
Stupid Cupid Had Me Falling For The Leader Of The Drapes cover
All I Ever Wanted cover
Why do I love you? (COMPLETED!!! In editing process) cover
Living it Big Time ~ A Big Time Rush Fan Fiction :{) cover
I am the King, Right? cover
Merely Lust cover
Everyone Needs A Hero.... Even You. A reader x Leonardo cover
Something Worth Fighting For cover
My Killer Romance cover

Stupid Cupid Had Me Falling For The Leader Of The Drapes

4 parts Complete

**I'm new to the Cry-Baby world and have only watched it once.... well twice since I'll be watching it as I write this story but I've been reading some Johnny Depp One shots.... which is how I was "introduced" to Cry-Baby an it "put me in the mood" to try my hand at writing a Cry-Baby story and this is it I'm sorry if I get anything wrong and/or people seem out of character** Cadence Clearwater who was named after her uncle Creedence was best friends with "Crybaby" Wade Walker and Mona "Hatchet-Face" Malnorowski when she was a child she was forced to move out of Baltimore when her father decided to move his family when she was 10 years old but she made a promise to Wade in a letter which said once she was old enough to live on her own she'd come back home to him and she keeps her promise after she graduates from school at the age of 18 but she isn't alone for she had adopted her 5 year old brother and sister to keep them away from their abusive father after their mother died the only issue is when she comes back Wade doesn't seem to remember her Mona does though Wade and Cadence remeet when she walks into a Candy Store looking for a job then again at Turkey Point where she "saves" him from Lenora Frigid by kissing him in front of her and saying he's "her man" it's a instant attraction for Wade but what about Cadence!? will she let him steal her heart like she let him have her first kiss!? what about Allison!? what sort or relationship will Wade have with the "Square" girl who instantly fell for him and his one lonely tear!?

More details