MY VERSION OF: The Mark Of Athena
BlueBellWood
  • Reads 32,535
  • Votes 65
  • Parts 13
  • Time 1h 13m
  • Reads 32,535
  • Votes 65
  • Parts 13
  • Time 1h 13m
BlueBellWood
Ongoing, First published Mar 24, 2012
anabethannabethargoathenacampdreamsfrankgaeagryphonshazeljasonjason-jupiterleomarkmedeapiperromanstsunami
This is my version of The Mark Of Athena. All rights go to Rick Riordan.

The Second Great Prophecy has started and the 7 halfbloods are traveling to Rome and Greece to save the gods for Gaea and the Giants. 
To get there, they will have to battle monsters, giants, and their fatal flaws...
All Rights Reserved
anabethannabethargoathenacampdreamsfrankgaeagryphonshazeljasonjason-jupiterleomarkmedeapiperromanstsunami
Table of contents

13 parts

Sign up to add MY VERSION OF: The Mark Of Athena to your library and receive updates
or
#20anabeth
Content Guidelines
You may also like
The Mark of Athena by seaweedbrain_11
13 parts Complete
Seven half blood set across to Rome to save Olympus and the world. I do not own any of the Percy Jackson and the Olympians or Heros of Olympus characters. All rights go to Rick Riodan.
House of Hades by musicaldreamer1808
49 parts Complete
(PROPHECY CHANGE!!! Sorry!!!) The Seven of the Great Prophecy has been narrowed down to five, as two of the strongest demigods in demigod history have fallen into Tartarus. Piper, Leo, Hazel, Frank and Jason, along with Nico di Angelo, son of Hades, must travel to the House of Hades in Epirus, Greece, where they promise to meet Percy and Annabeth. But will the two make it out of Tartarus alive? Journey on with the demigods to find out. Disclaimer: I do not own PJO or HOO or any of Rick Riordan's amazing creations. This is just a fanfic inspired by my imagination. Please read, comment and vote! (:
The Heroes of Olympus: The House of Hades by PJandKKfan
32 parts Complete
ALL RIGHTS GO TO RICK RIORDAN! This is my version of the sequel to The Mark of Athena, the upcoming fourth book in The Heroes of Olympus series: The House of Hades. I advise you not to read this unless you have read The Mark of Athena! Percy and Annabeth must survive Tarturus while the other five, led by Nico, must survive the trip to Epirus and the House of Hades and they must close both sides of the Doors of Death! But to close both sides, won't somebody have to stay behind?
The Blood of Olympus (Fan-Fic) by camp_hero
81 parts Complete
"Seven half-bloods shall answer the call To storm or fire the world must fall An oath to keep with a final breath And foes bear arms to the doors of death" These words may seem insignificant to a mortal, but to these half-bloods it means the world. Literally. A group of the seven most powerful demigods of their age must join forces to fight against Gaea's army and stop her from rising on the Feast of Spes. Can they do it? What will happen when the daughter of Athena cannot think of a plan? What will happen when the son of Poseidon fears his own domain? What will happen when the son of Hephaestus is unable to fix what he has broken? What will happen when the daughter of Pluto is at death's door yet again? What will happen when the great son of Mars burns up? What will happen when the mighty son of Jupiter falls? What will happen when the daughter of Aphrodite is no longer in control? [{I DONT OWN ANY OF THESE CHARACTERS!! Rick Riordan does. Enjoy!! }
The Mark of Athena [Discontinued] by StayNotaGrownUp
19 parts Complete
"Seven half-bloods shall answer the call" begins the Great Prophecy, but with Gaea's power growing, will the Greeks and Romans be able to pull together and fufill it? Alliances will be formed and Loyalties put to the ultimate test in this fan-fiction of The Mark of Athena.
Blessing of the gods by dutch_daydreamer
16 parts Complete
Ever since Percy went on the quest with Frank and Hazel, he has been hearing her whispering in his mind. Gaea keeps haunting him in his dreams. Telling him things during battle. Slowly taking over his mind. Percy fears that once they arive in Greece she will try to take control of him. Will he be strong enough to resist? Or will he be consumed by the darkness Gaea brings, and destroy camp and the demigods in the process? Are the gods willing to help their children during battle, or are they all alone? ---------- COMPLETED ! I do not own the characters or the idea of Percy Jackson. I did come up with this different ending of the original blood of olympus. ! First fan-fic I have ever decided to share 💙 #23 percabeth (16-10-19)
Argo II: After Tartarus by knifelady0
16 parts Complete
Percy and Annabeth have just returned from Tartarus and they both are struggling with being out and about on the Argo II. With the seven only a week away from facing Gaia in Athens, Gaia will do anything to slow them down. The seven are faced with their worst memories and secrets will be revealed as they journey through Epiales' sacred rooms. I DON'T OWN ANY OF THESE CHARACTERS - THEY ALL BELONG TO RICK RIORDAN AND HIS BOOKS. plz enjoy!!
The Blood of Olympus (Percy Jackson Fanfiction) by GodlyCupcakes
25 parts Complete
Percy and Annabeth are out of Tartarus and alive and the quest to stop Gaea continues. With Gaea nipping at their heels, she seemes to be throwing every single possible monster and beast to keep them from arriving in Greece in only fourteen days. The Seven of Great Prophecy embark on another deadly journey, but now seems as if it's simple game of chance whether or not they survive till the end.
A Demigod Love Story(Percy Jackson Fanfiction) by thatcutelittlefandom
15 parts Complete
After the war with Gaea, the Seven of the Prophecy start to settle down. Frank and Hazel went back to Camp Jupiter while Jason stayed with Piper and the other Greeks at Camp Half-Blood. Love is in the air when Leo finds the perfect girl, but finds out that their relationship might not be a walk in the park. Some information is a little off because the story was finished before Blood of Olympus. I am trying to tweak it to be more up-to-date as I write Disclaimer: I wish I owned the awesome characters, but sadly, I do not. Rick Riordan owns all of these characters (except the new one I made up).
The Mark of Athena (Fan-Fiction) by wanderIess
57 parts Complete
{completed} ✓ [UNEDITED. I highly recommend that you DO NOT read this. Thank you.] Six months ago, Percy Jackson, savior of Olympus, vanished from Camp Half-Blood. Hera was making a gamble with Jason Grace. The two leaders traded places by acting as the leaders. Now it's June. Annabeth, Jason, Piper, and Leo are flying on a giant warship to get Percy. The demigods for the Prophecy of Seven are Percy, Jason, Piper, Leo, Hazel, and Frank. That's only six. They must decide a seventh demigod before sailing to Rome to close the Doors of Death. With a new prophecy and new giants to defeat, Gaea is throwing everything she's got with surprises in store. [ATTENTION: I started writing this story in May 2012, which was before the real Mark of Athena came out. If I get another complaint/question about plagiarism, I will take down the first two chapters. Thank you.]
You may also like
Slide 1 of 10
The Mark of Athena cover
House of Hades cover
The Heroes of Olympus: The House of Hades cover
The Blood of Olympus (Fan-Fic) cover
The Mark of Athena [Discontinued] cover
Blessing of the gods cover
Argo II: After Tartarus cover
The Blood of Olympus (Percy Jackson Fanfiction) cover
A Demigod Love Story(Percy Jackson Fanfiction) cover
The Mark of Athena (Fan-Fiction) cover

The Mark of Athena

13 parts Complete

Seven half blood set across to Rome to save Olympus and the world. I do not own any of the Percy Jackson and the Olympians or Heros of Olympus characters. All rights go to Rick Riodan.

More details