Kidnapped BWWM
Marketable_Dreams
  • Reads 533
  • Votes 17
  • Parts 1
  • Time 7m
  • Reads 533
  • Votes 17
  • Parts 1
  • Time 7m
Marketable_Dreams
Ongoing, First published Aug 16, 2016
Mature
bdsmboyxboybwwmfrenchgangsgermanitaliankidnappedloverussianthrillerunexpectedwmbwyoung
"You kidnapped me because why" I asked handcuffed to the fridge.

"Our reasons-"

"Our business" 

"Awww that's cute y'all finish each other sentences" I laughed as the guys exchange looks.

"Well she's gonna be a riot" Jéron said laughing.

I kicked my shoe off which hit him in the stomach making him grunt holding his side.

"Get the needle for our marrone dea" Marlano spoked coldly starring at me.


"Oh come on that's not necessary" I nervously laughed and saw he wasn't playing.

"Here you go" the RJ smirked handing him the needle.

Marlano smiled crouching down his smile disappeared into a line.

Pain strucked through thigh I screamed in tears yanking my head back.

"Damn it Marlano" Dalè yelled furiously.

"Shit" Rj said starring at me with slight worry eyes.

My vision became blurry the tears slowly continue to run down my face everything went black.




Author speaking: If you wanna read more, add this book and read my chapters.
All Rights Reserved
bdsmboyxboybwwmfrenchgangsgermanitaliankidnappedloverussianthrillerunexpectedwmbwyoung
Table of contents

1 part

Sign up to add Kidnapped BWWM to your library and receive updates
or
Content Guidelines
You may also like
Beautiful in Jada by KindaWerid
26 parts Complete Mature
The strong pull to her. The desire to have something you never thought you would want again. A glance turned into an obsession. And he would stop at nothing to get her. He would do anything he could to keep her. He cared so much for only her Alessio Bucceri was a man who could have anything he ever wanted. Until he wanted that one thing to need him back. Circumstances run in his favor as the woman of his dreams landed into his domain. He would never let her go. A chance glance turned obsession. #1 BWWN! #1 Mafia [4/12/24] *Book excerpt* -- Her cheeks turned red, ever so slightly through her chocolate skin. Her skin looked and felt so smooth. She liked the compliments, the Italian flare. It ropes many women, but the way she looked at me with her big almond eyes had my mind racing and my body in overdrive. She was not immune to my charm, even in her current situation. Her hair was in a slick bun. I was sad not to be able to see the curls adorne her face. And yet she stared at me again, watching me like a dog. Curious gazes. It was fun to tease, and the response I got back over affirmed my teasing. She seemed more relaxed with me. She looked away from me. She stared out the window watching the street ride by. It was silent for a while as I texted my subordinates basic commands. Nothing conspicuous. "Alessio, where are you taking me," her voice piped up. Seems like it took her a while to muster up the courage. I loved her sweet voice when it spoke me me and when she said my name... It was such a turn-on. She wasn't supposed to really ask questions. I don't like lots of questions. I thought about the best way to respond but opted not to say anything at all. She was as stubborn as always, forgetful too. She scanned around me before huffing to herself and looking back out the window. -- Started 06/08/2023- 8/14/2023 Highest Rankings: #7 Arranged [4/26/24] #26 Older #1 Bwwm #13 Man #1 Mafia #1 lovetragedy #6 lovestory #5 Blackwomen
Wild Side (BWWM) by OtakuFaerie
48 parts Complete Mature
BOOK 1 MATURE CONTENT 18+ Read at your own risk I slowly lifted the thin long sleeve over her head and she sat up a little in the process to help me. As if I wasn't hard enough her pierced hard brown nipples stood straight out begging to be touched. I brought my left hand up to rub and pull on one of her nipples making her release a low moan. I attached my lips to the other sucking on it and flicking my tongue at it getting a good shake out of her. My hand that wasn't busy made its way into the band of her shorts to find she wasn't wearing any panties underneath. "Traviesa." I say meeting her lips with mines again as I swiped two fingers along her soaking wet slit. "Fuck neonata, you're so wet." I say against her lips and she bit back a moan at my words that clearly affected her. I then dipped a finger into her tight hole and she attempted to clamp her legs shut only for me to push them back up so they were bent at her sides. I sent a harsh slap to her inner thigh close to her clothed pussy startling her but she moaned at the feeling. - A story in which a young naive girl gets affiliated with Mateo Ayala-Ricci with many skeletons in the closet RANKINGS ⭐️: #1 in Cartel #2 in Rich #3 in illegal #5 in Agegap #8 in submissive #7 in blackgirl #2 in mobster #9 in drug #13 in Don #25 in BWWM ©Copyright 2021. All rights reserved. This fanfic may not be reproduced, displayed, modified or distributed without the express prior written permission of the copyright holder. For permission contact @OtakuFaerie- on wattpad.com. Thank you.
His Tesoro (The James Series book 1 )(BWWM) by sjpwell
54 parts Complete Mature
"let me tell you something, darling. you've unlocked a side of me, even I fear. but since you want to keep me up all night, challenging me, he's gonna show up at some point." Mateo whispers, huskily into my ear, gripping my neck. "what are you talking about?" I whisper. "like how I show no mercy when killing someone. I can also show no mercy in bed. you're not sensitive, so you should be able to take the degrading. right, Tesoro?" he asks, i nod. "you know it's not true though. you know I love and cherish you, beautiful," he says slowly. "right?" "mhm." I nod. Mateo slowly starts speeding up his thumb, on my clit. "right. now I know, my Tesoro isn't so vanilla and innocent. So tell me, love. do you have any kinks?" the question catches me off guard. do I? "ya," I mumble. "I want you to list them," he whispers, I can hear the smirk on his face. "bondage, CNC- shit- dirty talk, uh-um, choking, degrading, stimulation. fuck i can't think," I mumble. "you've said my favourites, but have you ever heard of darcyphilia?" he asks, slowly entering his finger again. "n-no." I stutter. "well, I want to fuck you, overstimulate you, edge you, until you're in tears, chanting your safe word." _________________________________ ⚠️ I WON'T CONSIDER THIS BDSM, BUT IT DOES CONTAIN HEAVY SMUT⚠️ ⚠️ THIS BOOK DOES NOT PROMOTE TEEN PREGNANCY⚠️ ⚠️EVERYTHING OTHER THEN THE MAFIA CULTURE AND RACIAL CULTURES ARE FICTION⚠️ ⚠️ THIS BOOK IS CONSIDERED 18+ BUT IF YOU THINK YOU CAN HANDLE IT... I AIN'T YOUR PARENT. BUT DON'T SAY I DIDN'T WARN YOU⚠️ ⚠️YES THE GIRL IS ON BIRTH CONTROL FROM THE GET-GO⚠️
Creepin | BxB by KingMotha
33 parts Complete Mature
" Let's keep this on the down-low. Nobody has to know. " He cooed in my ear, pushing up on me like a dog in heat. " I'm quick to cut a nigga off, so don't get comfortable. " I smirked, pushing his face back with my palm. He continued to pursue me knowing he had a secret of his own. I liked the way he set his eyes upon me and determined he'd have me. He made me feel comfort in all areas that I'd lacked before. There was something burning in the back of my mind... was he really mines? We only spoke late night, and those conversations were brief. When he was around me he was like a kid in a candy store trying to get his hands on anything he could from me. That was until I saw him... with another. That's where his time had been going. As he secrets unfolded I realized he'd been Creepin' All Rights Reserved
Obsession. by jezxzica
33 parts Complete Mature
If you like fantasy/romance you should try my story The Flower Longed Death. It is written a lot better than this one is! -------------------------- "You must've got the wrong impression if you keep expecting to get away with shit like this, so let me make things clear," He says with a calm smile. He moves his face closer to mine, losing the lighthearted grin that had previously cooled my nerves. I get a better look at the scar across the bridge of his nose, and the vague one X'ed onto his lips. Now I want them even more. -------------------------- Eighteen year old Mileva never thought her past would catch up to her after leaving years ago to live in New York City. She didn't think she wanted it to. However, she also didn't think she would cross paths with a guy like Valen, the Italian Mafia's heir. He's only twenty three, but he's somehow the most attractive and intimidating man she has ever met, let alone heard of. Mileva battles her anxiety adjusting to this new life of hers, while Valen is just getting comfortable with his new obsession. -------------------------- Word count: 110,000 There is a lot of graphic content, so please read carefully! List of specific warnings can be found in the introduction. The writing gets better as the story progresses, I promise.
The Servant [BXB] by Nettyna96
16 parts Complete Mature
"What do you expect me to do? I have been an orphan since a young age, my foster parents kicked me out. The money is not infinite for me and I need a place to stay. I can't be with you two. You have no privacy at all." I mumbled and fixed my tie, as I started to feel slightly uncomfortable. ********** "Yes sir." I could not say more, because I felt that my voice would be shaking because of the nervosity. "Well great then." The man stood up, walked right behind me. "Loosen your tie a bit." He again said with a dark voice, yet again I obeyed him like a puppy ********** This is a fanfiction that is inspired by VegasPete characters from KinnPorsche novel. Alternate Universe, no mafia world. Violent scenes, mature content, self harm, depression will appear in chapters. Please do not read if you will not feel comfortable. Kindly note that English is not my main language, hence grammar mistakes might appear. ************
𝐇𝐢𝐬 𝐏𝐞𝐫𝐬𝐨𝐧𝐚𝐥 𝐀𝐬𝐬𝐢𝐬𝐭𝐚𝐧𝐭 | ✓ by EroticeNoire
78 parts Complete Mature
✓ COMPLETED ✓ Started: 16th OCT 2020 Finished: 14th FEB 2021 EDITING! Finally out of the orphanage, Arabella needs to find a job with a good pay that she'll be able to provide for herself. When young Italian millionaire, Vincenzo Varallo hires her to be his personal assistant she has to try and ignore his charms to focus on her job as well as find out where she came from. *+*+* "Mr Varallo," I begin slowly. "Our relationship is supposed to be strictly professional." I protest pushing his body away from mine but that just seemed to make him want to come closer. "I'm your boss, right?" He asks, bringing his lips closer to mine. I nod my head only because I'm afraid a squeak may exit my mouth. "Then I order you to go on your knees and suck." He smirks. *+*+* #1 Explicitlanguage - 13|01|21 #1 Don 24|02|21 #1 Darkromance 01|03|21 #1 Mob - 06|03|21 #2 Gắng - 11|04|21 #2 Hate - 22|04|21 #2 Boyxgirl - 23|04|21 #1 Lust - 27|04|21 #1 Gắng - 18|07|21
His Wicked Games (2025) by mariebxy
13 parts Ongoing Mature
"Look at me" he demanded, grabbing my chin with force. "You're still mine." His fingers dig into my thigh, a painful reminder of his presence. "Do you understand me?" He leans in closer, his breath hot against my ear. "Say it," he whispered. "I won't." I flinched, trying to pull away, but his grip only tightened more. "Don't try to run mami," his lips trailed down my neck sending shivers down my spine. "You can't escape me." His lips find the sensitive spot just below my ear, "Say it," he repeated, his voice a seductive caress. "Tell me you're mine." "I..." I began, my voice a soft whisper. I couldn't finish the sentence. I was too distracted by the way he nipped at my skin, a painful bite that sent a jolt of unwanted pleasure through me. "Say it," he urged, his voice laced with amusement. "Or I'll make you." | Book 2 | MATURE CONTENT! 18+ ⚠️ Cover by me :)
Frost Bite | MxM by Shelby_Knight
10 parts Ongoing Mature
After being left for dead in the woods, Viper never thought he would find his happily ever after, not since the brutal murder of his best friend- his twin sister. Once he became the Capo of the most influential mafia, The Wolfe Pack, life became nothing more than blood, sweat, and tears. When he's sent on an assignment to gather intel on an illegal trafficking ring in his city, he wasn't prepared for his heart to start beating once again in his stone cold chest after laying his eyes on the blond Adonis beating his opponent to a bloody pulp in the fighting cage. After being orphaned at the age of 13, Dante was shipped off to a group home where he was raised till he chaptered out of the foster system. Dante was on a scholarship at the local university where he was approached by a scout wanting him to join his program, and he hopped at the chance doing the thing one he loved the most, wrestling. But after an incident that left him fighting for his life, he found himself forced into a life of servitude. Five years later, he's a shell of his old self, going through the motions and just trying to survive. Then one night, he's thrown into a room with a male with obsidian eyes who would change his life forever. But would it be for the better or worse? ___________________________ ⚠️ WARNING ⚠️ This book is DARK, containing triggering themes and is NOT suitable for minors. This book is also about a relationship between two adult men. If that ain't your cup of tea then you better back out now because this is not the book for you. ----------------------
ECSTASY by shay_believe
41 parts Complete Mature
My body was stuck. I wanted to move but I couldn't. He leaned down and our lips crashed together. He made the kiss deeper by adding tongue and picked me up giving my ass a squeeze. Earning a moan from me. He began walking upstairs and went straight to my room throwing me on the bed. "I missed you so fucking much." He said aggressively as he took his clothes off. I started taking mines off as well. He laid over my body kissing me again then breaking it-pressing his forehead to mine looking me in my eyes. I arch my back as he reach down to my soaking pussy and he started stroking my clit. "Always so fucking wet, I fucking love it." He continues to rub his fingers up and down my slit. Sticking a finger inside of me every so often. I moan out against his fingers on my clit. "Fuck this I need to be inside of you." He grunts. A love story about Antonio Russo & Shakayla Janai. Not fully edited! Let me know if I made a mistake somewhere!!! But not to much tho 😚 some of y'all be getting smart in the comments 🙃 I definitely return energy.
You may also like
Slide 1 of 10
Beautiful in Jada cover
Wild Side (BWWM) cover
His Tesoro (The James Series book 1 )(BWWM) cover
Creepin | BxB cover
Obsession. cover
The Servant [BXB] cover
𝐇𝐢𝐬 𝐏𝐞𝐫𝐬𝐨𝐧𝐚𝐥 𝐀𝐬𝐬𝐢𝐬𝐭𝐚𝐧𝐭 | ✓ cover
His Wicked Games (2025) cover
Frost Bite | MxM cover
ECSTASY cover

Beautiful in Jada

26 parts Complete Mature

The strong pull to her. The desire to have something you never thought you would want again. A glance turned into an obsession. And he would stop at nothing to get her. He would do anything he could to keep her. He cared so much for only her Alessio Bucceri was a man who could have anything he ever wanted. Until he wanted that one thing to need him back. Circumstances run in his favor as the woman of his dreams landed into his domain. He would never let her go. A chance glance turned obsession. #1 BWWN! #1 Mafia [4/12/24] *Book excerpt* -- Her cheeks turned red, ever so slightly through her chocolate skin. Her skin looked and felt so smooth. She liked the compliments, the Italian flare. It ropes many women, but the way she looked at me with her big almond eyes had my mind racing and my body in overdrive. She was not immune to my charm, even in her current situation. Her hair was in a slick bun. I was sad not to be able to see the curls adorne her face. And yet she stared at me again, watching me like a dog. Curious gazes. It was fun to tease, and the response I got back over affirmed my teasing. She seemed more relaxed with me. She looked away from me. She stared out the window watching the street ride by. It was silent for a while as I texted my subordinates basic commands. Nothing conspicuous. "Alessio, where are you taking me," her voice piped up. Seems like it took her a while to muster up the courage. I loved her sweet voice when it spoke me me and when she said my name... It was such a turn-on. She wasn't supposed to really ask questions. I don't like lots of questions. I thought about the best way to respond but opted not to say anything at all. She was as stubborn as always, forgetful too. She scanned around me before huffing to herself and looking back out the window. -- Started 06/08/2023- 8/14/2023 Highest Rankings: #7 Arranged [4/26/24] #26 Older #1 Bwwm #13 Man #1 Mafia #1 lovetragedy #6 lovestory #5 Blackwomen

More details