Story cover for Kidnapped BWWM by Marketable_Dreams
Kidnapped BWWM
Marketable_Dreams
  • WpView
    LECTURAS 537
  • WpVote
    Votos 17
  • WpPart
    Partes 1
  • WpHistory
    Hora 7m
  • WpView
    LECTURAS 537
  • WpVote
    Votos 17
  • WpPart
    Partes 1
  • WpHistory
    Hora 7m
Marketable_Dreams
Continúa, Has publicado ago 16, 2016
Contenido adulto
bdsmboyxboybwwmfrenchgangsgermanitaliankidnappedloverussianthrillerunexpectedwmbwyoung
"You kidnapped me because why" I asked handcuffed to the fridge.

"Our reasons-"

"Our business" 

"Awww that's cute y'all finish each other sentences" I laughed as the guys exchange looks.

"Well she's gonna be a riot" Jéron said laughing.

I kicked my shoe off which hit him in the stomach making him grunt holding his side.

"Get the needle for our marrone dea" Marlano spoked coldly starring at me.


"Oh come on that's not necessary" I nervously laughed and saw he wasn't playing.

"Here you go" the RJ smirked handing him the needle.

Marlano smiled crouching down his smile disappeared into a line.

Pain strucked through thigh I screamed in tears yanking my head back.

"Damn it Marlano" Dalè yelled furiously.

"Shit" Rj said starring at me with slight worry eyes.

My vision became blurry the tears slowly continue to run down my face everything went black.




Author speaking: If you wanna read more, add this book and read my chapters.
Todos los derechos reservados
bdsmboyxboybwwmfrenchgangsgermanitaliankidnappedloverussianthrillerunexpectedwmbwyoung
Tabla de contenidos

1 parte

Regístrate para añadir Kidnapped BWWM a tu biblioteca y recibir actualizaciones
O
Pautas de Contenido
Quizás también te guste
She never existed de folkswave
23 partes Concluida Contenido adulto
This is book 2 of 6 days "Can I kiss you" he asked now looking at me "Yes" I breath out . He brings his lips close to mine and just when he was about to kiss me "Not like this" he says as he stands up Going on his knee's he raises my shirt up . He pulls my legs to the edge of the bed as he did that my covered pussy pressed onto his lips. Throwing my head back a deep breathless chuckle left his lips "I haven't even removed these and I already got a reaction out of you" He says playing with hem of my lace It's been 5 years and Zuri is nowhere to be found. It's as if she never existed but for Zuri her life has been going on like her and Mark never even happened The love story continues will they get their happy ever after or will destiny tear them apart
Drake's Kitten (completed) de Yellow1017
32 partes Concluida
He once told me no one knows the real him.I didn't think he meant it, and not in a good way. He is a straight A student, and everyone knows it, not to mention he is on the swim team. All that though isn't the real him, the real him hides deep within himself. ---------- "Can you please tell me what that was?" I nearly shout at him. All I get is silence. He keeps his back to me. "Please, I need some explanation." I beg. I stay still as he stops dead in his tracks. His body is tense and it's scarring me. He turns around slowly to face me with his hands at his sides. His eyes meet mine, but there is no spark of any emotion in them. They are cold and dark making me look away not being able to hold his deadly stare. I feel uneasy under his gaze, and i feel his eyes burning a hole in the side of my face. "No, I won't explain because it's not important." He says in a low, almost, growl. I flinch and look back into his eyes. I feel hurt by his words and I don't know why, but I know he sees it in my eyes. His faces flashes with regret but it's quickly covered up with his faces going back to it's hard cold look. I feel my heart stop and my face go pale. His look terrified me making me hold my breath. "Breath." He orders. I start to breathe again and just blink at him. "Now go." He orders me again. I flinch involuntarily at his tone and jump back slightly. "Please don't let me walk home alone." I beg in a quiet voice, looking down at my feet. The next thing I see are his black combat boots right in front of my shoes. I look up into his eyes and he looks down into mine confusion written all over his face. "How come you aren't running yet?" He questions searching my eyes. "I just can't walk home alone, please I'm scared." I hear him chuckle. "You aren't afraid of me? What can possibly be scarier than me?" He asks. "Well, I know you will keep me safe." "Why is that?" He questions raising an eyebrow at me. "You haven't hurt me." "Yet." He mutters, but I roll my eyes.
His Tesoro (The James Series book 1 )(BWWM) de sjpwell
54 partes Concluida Contenido adulto
BIG DISCLAIMER: I wrote this book when I was a CHILD. The MC's are underage. If it makes you uncomfortable, please DO NOT read. This book is still up due to it being a comfort book, outside the smut. It touches on mental health and can be relatable. PLEASE, THIS IS A WARNING! THEY ARE UNDERAGE. "let me tell you something, darling. you've unlocked a side of me, even I fear. but since you want to keep me up all night, challenging me, he's gonna show up at some point." Mateo whispers, huskily into my ear, gripping my neck. "what are you talking about?" I whisper. "like how I show no mercy when killing someone. I can also show no mercy in bed. you're not sensitive, so you should be able to take the degrading. right, Tesoro?" he asks, i nod. "you know it's not true though. you know I love and cherish you, beautiful," he says slowly. "right?" "mhm." I nod. Mateo slowly starts speeding up his thumb, on my clit. "right. now I know, my Tesoro isn't so vanilla and innocent. So tell me, love. do you have any kinks?" the question catches me off guard. do I? "ya," I mumble. "I want you to list them," he whispers, I can hear the smirk on his face. "bondage, CNC- shit- dirty talk, uh-um, choking, degrading, stimulation. fuck i can't think," I mumble. "you've said my favourites, but have you ever heard of darcyphilia?" he asks, slowly entering his finger again. "n-no." I stutter. "well, I want to fuck you, overstimulate you, edge you, until you're in tears, chanting your safe word." _________________________________ ⚠️ I WON'T CONSIDER THIS BDSM, BUT IT DOES CONTAIN HEAVY SMUT⚠️ ⚠️ THIS BOOK DOES NOT PROMOTE TEEN PREGNANCY⚠️ ⚠️EVERYTHING OTHER THEN THE MAFIA CULTURE AND RACIAL CULTURES ARE FICTION⚠️ ⚠️ THIS BOOK IS CONSIDERED 18+ BUT IF YOU THINK YOU CAN HANDLE IT... I AIN'T YOUR PARENT. BUT DON'T SAY I DIDN'T WARN YOU⚠️ ⚠️YES THE GIRL IS ON BIRTH CONTROL FROM THE GET-GO⚠️
Beautiful in Jada de KindaWerid
26 partes Concluida Contenido adulto
The strong pull to her. The desire to have something you never thought you would want again. A glance turned into an obsession. And he would stop at nothing to get her. He would do anything he could to keep her. He cared so much for only her Alessio Bucceri was a man who could have anything he ever wanted. Until he wanted that one thing to need him back. Circumstances run in his favor as the woman of his dreams landed into his domain. He would never let her go. A chance glance turned obsession. #1 BWWN! #1 Mafia [4/12/24] *Book excerpt* -- Her cheeks turned red, ever so slightly through her chocolate skin. Her skin looked and felt so smooth. She liked the compliments, the Italian flare. It ropes many women, but the way she looked at me with her big almond eyes had my mind racing and my body in overdrive. She was not immune to my charm, even in her current situation. Her hair was in a slick bun. I was sad not to be able to see the curls adorne her face. And yet she stared at me again, watching me like a dog. Curious gazes. It was fun to tease, and the response I got back over affirmed my teasing. She seemed more relaxed with me. She looked away from me. She stared out the window watching the street ride by. It was silent for a while as I texted my subordinates basic commands. Nothing conspicuous. "Alessio, where are you taking me," her voice piped up. Seems like it took her a while to muster up the courage. I loved her sweet voice when it spoke me me and when she said my name... It was such a turn-on. She wasn't supposed to really ask questions. I don't like lots of questions. I thought about the best way to respond but opted not to say anything at all. She was as stubborn as always, forgetful too. She scanned around me before huffing to herself and looking back out the window. -- Started 06/08/2023- 8/14/2023 Highest Rankings: #7 Arranged [4/26/24] #26 Older #1 Bwwm #13 Man #1 Mafia #1 lovetragedy #6 lovestory #5 Blackwomen
EVE de Katty_0149
96 partes Continúa Contenido adulto
When a beautiful African girl just starting her adulthood is kidnapped from her country and sold off to the Mafia, her life does a full 360. Will she be able to cope? ############### *She quickly gets on her knees and bows in front of me. "What are you atoning for?" I ask "I b-broke your cologne. I didn't mean to. I s-swear, it was a mistake. I was wiping the counter and I didn't see it, all I saw was the bottle broken on the floor and the carpet wet." She explains panicky. "And?" I ask trying not to sound amused. The sight in front of me is pleasing. The things I do to women on thier knees "I accept whatever punishment the Don gives" she says*
Blind As a Bat [1st book complete] de Azruek
49 partes Concluida Contenido adulto
Book 1 He was cast to the edges of his clan. His father could not stand to even look at him. His baby sister probably didn't even know he was her brother... All because he, unlike all other vampire (The correct terminology will be Wanpyrkos; van-peer-coe-s) kind, was born blind. And what do all creatures do to those that are different, those that do not fit society, those that they think should not have been born to this civilized society...? [Book Cover Made by the wonderful THEMIDNIGHTECLIPSE13] - thank you! I'm only introducing the perspective of the main character for the first part. Things change drastically soon after that. [BDSM entries are clearly marked and written so they can be skipped without affecting the story] ***A couple scenes to whet your palate*** 1. "Uh, we heal from pretty much everything and anything. Have you ever tried physically damaging your eyes to see if they would fully heal?" "N-no. No, it doesn't work," I forced out, my voice a little strangled and cracking before hardening. "And stuff like that, isn't that just wrong?! Hurting someone just to 'fix' them." 2. I leaned and he met me, our soft lips touching and moving perfectly on each other's. I felt as his tongue ran the slit of my lips, my tongue coming to graze it as it passed over, knowing doing so was like catnip to him. He leaned closer, and I shivered as his hands ran from low on my hips and grazed along and up my ribs, pulling my chest closer to his so my body arched and rubbed against him. I hummed in appreciation. [warning: so far aggressive or physical bullying and maybe a little kidnappage and sexual themes as well as possible trigger warnings]
13 Dates With Me de laila_thewriter
13 partes Continúa Contenido adulto
{Book Two of His Bride} "Oh come on pretty boy, just one date. That's all I'm asking" he practically pleaded with me. His eyes held hope in them "Seriously dude, leave me alone" I shooed him off as I continued downing my drink. "One date. Please" he asked again, he took the cup from my hand making me glare hard at him and motion for the bartender to hand me another "Please" his pleading was beginning to irritate me. "Sure, whatever" I mumbled, resting my head on my arms which laid flat on the table. "You won't regret it, I swear" he cheered, took my hand in his hands, gave it a squeeze and left the bar. ...... Danny got his heart broken when the person he claimed to have fallen in love with, chose his best friend over him. He reunites with a man who claims to have fallen for him at first sight. So now he has 13 dates to win Danny's heart. Will it end in happiness or sadness...... This can be a stand alone...
Creepin | BxB de KingMotha
33 partes Concluida Contenido adulto
" Let's keep this on the down-low. Nobody has to know. " He cooed in my ear, pushing up on me like a dog in heat. " I'm quick to cut a nigga off, so don't get comfortable. " I smirked, pushing his face back with my palm. He continued to pursue me knowing he had a secret of his own. I liked the way he set his eyes upon me and determined he'd have me. He made me feel comfort in all areas that I'd lacked before. There was something burning in the back of my mind... was he really mines? We only spoke late night, and those conversations were brief. When he was around me he was like a kid in a candy store trying to get his hands on anything he could from me. That was until I saw him... with another. That's where his time had been going. As he secrets unfolded I realized he'd been Creepin' All Rights Reserved
𝐇𝐢𝐬 𝐏𝐞𝐫𝐬𝐨𝐧𝐚𝐥 𝐀𝐬𝐬𝐢𝐬𝐭𝐚𝐧𝐭 | ✓ de EroticeNoire
78 partes Concluida Contenido adulto
✓ COMPLETED ✓ Started: 16th OCT 2020 Finished: 14th FEB 2021 EDITING! Finally out of the orphanage, Arabella needs to find a job with a good pay that she'll be able to provide for herself. When young Italian millionaire, Vincenzo Varallo hires her to be his personal assistant she has to try and ignore his charms to focus on her job as well as find out where she came from. *+*+* "Mr Varallo," I begin slowly. "Our relationship is supposed to be strictly professional." I protest pushing his body away from mine but that just seemed to make him want to come closer. "I'm your boss, right?" He asks, bringing his lips closer to mine. I nod my head only because I'm afraid a squeak may exit my mouth. "Then I order you to go on your knees and suck." He smirks. *+*+* #1 Explicitlanguage - 13|01|21 #1 Don 24|02|21 #1 Darkromance 01|03|21 #1 Mob - 06|03|21 #2 Gắng - 11|04|21 #2 Hate - 22|04|21 #2 Boyxgirl - 23|04|21 #1 Lust - 27|04|21 #1 Gắng - 18|07|21
Quizás también te guste
Slide 1 of 9
She never existed cover
Drake's Kitten (completed) cover
His Tesoro (The James Series book 1 )(BWWM) cover
Beautiful in Jada cover
EVE cover
Blind As a Bat [1st book complete] cover
13 Dates With Me cover
Creepin | BxB cover
𝐇𝐢𝐬 𝐏𝐞𝐫𝐬𝐨𝐧𝐚𝐥 𝐀𝐬𝐬𝐢𝐬𝐭𝐚𝐧𝐭 | ✓ cover

She never existed

23 partes Concluida Contenido adulto

This is book 2 of 6 days "Can I kiss you" he asked now looking at me "Yes" I breath out . He brings his lips close to mine and just when he was about to kiss me "Not like this" he says as he stands up Going on his knee's he raises my shirt up . He pulls my legs to the edge of the bed as he did that my covered pussy pressed onto his lips. Throwing my head back a deep breathless chuckle left his lips "I haven't even removed these and I already got a reaction out of you" He says playing with hem of my lace It's been 5 years and Zuri is nowhere to be found. It's as if she never existed but for Zuri her life has been going on like her and Mark never even happened The love story continues will they get their happy ever after or will destiny tear them apart

Más detalles